| PDBID: | 8r1x | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-02 |
|
| PDBID: | 8yfb | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Human PIEZO1-1988V | | Authors: | Zhang, M.F. | | Deposition date: | 2024-02-24 | | Release date: | 2025-02-24 |
|
| PDBID: | 9fu0 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-06-25 |
|
| PDBID: | 8r1r | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2023-11-02 | | Release date: | 2024-11-02 |
|
| PDBID: | 8yfc | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Human PIEZO1-A1988V-MDFIC | | Authors: | Zhang, M.F. | | Deposition date: | 2024-02-24 | | Release date: | 2025-02-24 |
|
| PDBID: | 9ftw | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-06-25 |
|
| PDBID: | 8r1q | | Status: | HOLD -- hold until a certain date | | Title: | SARS-CoV-2 Mpro (Omicron, P132H+T169S) in complex with alpha-ketoamide 13b-K | | Authors: | Sun, X., Ibrahim, M., Hilgenfeld, R. | | Deposition date: | 2023-11-02 | | Release date: | 2023-11-30 |
|
| PDBID: | 8yff | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Human PIEZO1--E756del-MDFIC | | Authors: | Zhang, M.F. | | Deposition date: | 2024-02-24 | | Release date: | 2025-02-24 |
|
| PDBID: | 9ftu | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-06-25 |
|
| PDBID: | 8r24 | | Status: | HOLD -- hold until a certain date | | Title: | SARS-CoV-2 Mpro (Omicron, P132H+T169S) free enzyme | | Authors: | Sun, X., Ibrahim, M., El Kilani, H., Hilgenfeld, R. | | Deposition date: | 2023-11-02 | | Release date: | 2023-11-30 |
|
| PDBID: | 8yfg | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Human PIEZO1-R2456H | | Authors: | Zhang, M.F. | | Deposition date: | 2024-02-24 | | Release date: | 2025-02-24 |
|
| PDBID: | 9ftv | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-06-25 |
|
| PDBID: | 8r1k | | Status: | HPUB -- hold until publication | | Title: | Pim1 in complex with 6-bromobenzo[d]oxazol-2-amine and Pimtide | | Authors: | Hochban, P.M.M., Heine, A., Diederich, W.E. | | Deposition date: | 2023-11-02 | | Sequence: | >Entity 1
SMLLSKINSLAHLRAAPCNDLHATKLAPGKEKEPLESQYQVGPLLGSGGFGSVYSGIRVSDNLPVAIKHVEKDRISDWGELPNGTRVPMEVVLLKKVSSGFSGVIRLLDWFERPDSFVLILERPEPVQDLFDFITERGALQEELARSFFWQVLEAVRHCHNCGVLHRDIKDENILIDLNRGELKLIDFGSGALLKDTVYTDFDGTRVYSPPEWIRYHRYHGRSAAVWSLGILLYDMVCGDIPFEHDEEIIGGQVFFRQRVS(SEP)ECQHLIRWCLALRPSDRPTFEEIQNHPWMQDVLLPQETAEIHLHSLSPGPS
>Entity 2
ARKRRRHPSGPPTA
|
|
| PDBID: | 8yf6 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-24 |
|
| PDBID: | 9fts | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-06-25 |
|
| PDBID: | 8r1w | | Status: | HPUB -- hold until publication | | Title: | Pim1 in complex with 4-(5-(4-aminophenyl)-2H-1,2,3-triazol-4-yl)benzoic acid and Pimtide | | Authors: | Hochban, P.M.M., Heine, A., Diederich, W.E. | | Deposition date: | 2023-11-02 | | Sequence: | >Entity 1
SMLLSKINSLAHLRAAPCNDLHATKLAPGKEKEPLESQYQVGPLLGSGGFGSVYSGIRVSDNLPVAIKHVEKDRISDWGELPNGTRVPMEVVLLKKVSSGFSGVIRLLDWFERPDSFVLILERPEPVQDLFDFITERGALQEELARSFFWQVLEAVRHCHNCGVLHRDIKDENILIDLNRGELKLIDFGSGALLKDTVYTDFDGTRVYSPPEWIRYHRYHGRSAAVWSLGILLYDMVCGDIPFEHDEEIIGGQVFFRQRVS(SEP)ECQHLIRWCLALRPSDRPTFEEIQNHPWMQDVLLPQETAEIHLHSLSPGPS
>Entity 2
ARKRRRHPSGPPTA
|
|
| PDBID: | 8yf7 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-24 |
|
| PDBID: | 9fty | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-06-25 |
|
| PDBID: | 8r20 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-02 |
|
| PDBID: | 8yfm | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of FIP200 claw/TNIP1_FIR_pS122 | | Authors: | Lv, M.Q., Wu, S.M. | | Deposition date: | 2024-02-24 |
|
| PDBID: | 9ftp | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-06-25 |
|
| PDBID: | 8r21 | | Status: | HPUB -- hold until publication | | Title: | Alpha-1-antitrypsin (Ile340Trp) in the native conformation | | Authors: | Aldobiyan, I., Lee, H.J., Lomas, D.A., Irving, J.A. | | Deposition date: | 2023-11-02 | | Sequence: | >Entity 1
MRGSHHHHHHTDPQGDAAQKTDTSHHDQDHPTFNKITPNLAEFAFSLYRQLAHQSNSTNIFFSPVSIATAFAMLSLGTKADTHDEILEGLNFNLTEIPEAQIHEGFQELLRTLNQPDSQLQLTTGNGLFLSEGLKLVDKFLEDVKKLYHSEAFTVNFGDTEEAKKQINDYVEKGTQGKIVDLVKELDRDTVFALVNYIFFKGKWERPFEVKDTEEEDFHVDQVTTVKVPMMKRLGMFNIQHCKKLSSWVLLMKYLGNATAIFFLPDEGKLQHLENELTHDIITKFLENEDRRSASLHLPKLSITGTYDLKSVLGQLGITKVFSNGADLSGVTEEAPLKLSKAVHKAVLTWDEKGTEAAGAMFLEAIPMSIPPEVKFNKPFVFLMIEQNTKSPLFMGKVVNPTQK
|
|
| PDBID: | 8yfp | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Chito oligosaccharide deacetylase from vibrio campbellii (VhCOD) | | Authors: | Sirikan, P., Tamo, F., Robinson, R.C., Wipa, S. | | Deposition date: | 2024-02-25 |
|
| PDBID: | 9ftr | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Drosophila golgi alpha-mannosidase II (dGMII) in complex with amide modified swainsonine-configured alkyl indolizidine | | Authors: | Bennett, M., Koemans, T., Overkleeft, H.S., Davies, G.J. | | Deposition date: | 2024-06-25 |
|
| PDBID: | 9ftq | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Drosophila golgi alpha-mannosidase II (dGMII) in complex with swainsonine-configured alkyl indolizidine | | Authors: | Bennett, M., Koemans, T., Overkleeft, H.S., Davies, G.J. | | Deposition date: | 2024-06-25 |
|
