| PDBID: | 9epd | | Status: | HPUB -- hold until publication | | Title: | DtpAa Y389F 8 fs 10 microjoules XFEL Pulse Data Collection | | Authors: | Williams, L.J., Owen, R.L., Worrall, J.A.R., Hough, M.A. | | Deposition date: | 2024-03-18 |
|
| PDBID: | 8w1g | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-15 |
|
| PDBID: | 8w13 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-15 |
|
| PDBID: | 9ep9 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-18 |
|
| PDBID: | 9epg | | Status: | HPUB -- hold until publication | | Title: | DtpAa Y389F 24 fs 10 microjoules XFEL Pulse Data Collection | | Authors: | Williams, L.J., Owen, R.L., Worrall, J.A.R., Hough, M.A. | | Deposition date: | 2024-03-18 |
|
| PDBID: | 8w14 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-15 |
|
| PDBID: | 8w1m | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-16 |
|
| PDBID: | 9eph | | Status: | HPUB -- hold until publication | | Title: | DtpAa Y389F 53 fs 100 microjoules XFEL Pulse Data Collection | | Authors: | Williams, L.J., Owen, R.L., Worrall, J.A.R., Hough, M.A. | | Deposition date: | 2024-03-18 |
|
| PDBID: | 9epi | | Status: | HPUB -- hold until publication | | Title: | DtpAa Y389F 53 fs 10 microjoules XFEL Pulse Data Collection | | Authors: | Williams, L.J., Owen, R.L., Worrall, J.A.R., Hough, M.A. | | Deposition date: | 2024-03-18 |
|
| PDBID: | 8w1j | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-16 |
|
| PDBID: | 9epc | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Cryo-EM structure of the Plastid-encoded RNA polymerase from Sinapis alba | | Authors: | Effantin, G., Blanvillain, R., Cobessi, D. | | Deposition date: | 2024-03-18 |
|
| PDBID: | 8w1k | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-16 |
|
| PDBID: | 8w1p | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-16 |
|
| PDBID: | 9ep8 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of ROCK2 in complex with a 8-(azaindolyl)-benzoazepinone inhibitor | | Authors: | Pala, D., Clark, D., Pioselli, B., Accetta, A., Rancati, F. | | Deposition date: | 2024-03-18 | | Sequence: | >Entity 1
GAAGDGAGASRQRKLEALIRDPRSPINVESLLDGLNSLVLDLDFPALRKNKNIDNFLNRYEKIVKKIRGLQMKAEDYDVVKVIGRGAFGEVQLVRHKASQKVYAMKLLSKFEMIKRSDSAFFWEERDIMAFANSPWVVQLFYAFQDDRYLYMVMEYMPGGDLVNLMSNYDVPEKWAKFYTAEVVLALDAIHSMGLIHRDVKPDNMLLDKHGHLKLADFGTCMKMDETGMVHCDTAVGTPDYISPEVLKSQGGDGFYGRECDWWSVGVFLYEMLVGDTPFYADSLVGTYSKIMDHKNSLCFPEDAEISKHAKNLICAFLTDREVRLGRNGVEEIRQHPFFKNDQWHWDNIRETAAPVVPELSSDIDSSNFDDIEDDKGDVETFPIPKAFVGNQLPFIGFTYYR
|
|
| PDBID: | 8w1q | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-17 |
|
| PDBID: | 8j3f | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2023-04-16 | | Release date: | 2024-10-16 |
|
| PDBID: | 9epj | | Status: | HPUB -- hold until publication | | Title: | DtpAa Y389F 41 fs 10 microjoules XFEL Pulse Data Collection | | Authors: | Williams, L.J., Owen, R.L., Worrall, J.A.R., Hough, M.A. | | Deposition date: | 2024-03-18 |
|
| PDBID: | 8w1t | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Title: | SARS-CoV-2 Main protease bound to a non-covalent non-peptidic HTS hit | | Authors: | Bian, X., Tang, S., Sacchettini, J.C. | | Deposition date: | 2024-02-18 |
|
| PDBID: | 8j3g | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2023-04-16 | | Release date: | 2024-10-16 |
|
| PDBID: | 9epe | | Status: | HPUB -- hold until publication | | Title: | 8fs pulse duration 10uJ pulse energy thaumatin | | Authors: | Owen, R.L., Hough, M.A., Worrall, J., Williams, L. | | Deposition date: | 2024-03-18 | | Sequence: | >Entity 1
ATFEIVNRCSYTVWAAASKGDAALDAGGRQLNSGESWTINVEPGTNGGKIWARTDCYFDDSGSGICKTGDCGGLLRCKRFGRPPTTLAEFSLNQYGKDYIDISNIKGFNVPMNFSPTTRGCRGVRCAADIVGQCPAKLKAPGGGCNDACTVFQTSEYCCTTGKCGPTEYSRFFKRLCPDAFSYVLDKPTTVTCPGSSNYRVTFCPTA
|
|
| PDBID: | 8w1u | | Status: | HPUB -- hold until publication | | Title: | SARS-CoV-2 Main protease bound to non-covalent lead molecule NZ-804 | | Authors: | Bian, X., Tang, S., Sacchettini, J.C. | | Deposition date: | 2024-02-18 |
|
| PDBID: | 8j3h | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2023-04-16 | | Release date: | 2024-10-16 |
|
| PDBID: | 9epn | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-19 |
|
| PDBID: | 8w23 | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of human tankyrase 2 SAM-PARP filament bound to compound, TDI-2804 (consensus map). | | Authors: | Malone, B.F., Zimmerman, J.L., Dow, L.E., Hite, R.K. | | Deposition date: | 2024-02-19 |
|
| PDBID: | 8j3i | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2023-04-16 | | Release date: | 2024-10-16 |
|
