| PDBID: | 8r0m | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-31 |
|
| PDBID: | 8yef | | Status: | HPUB -- hold until publication | | Title: | HPV6 L1 pentamer in complex with Fab F5-77 | | Authors: | Wang, X., Fu, W. | | Deposition date: | 2024-02-22 |
|
| PDBID: | 9ft2 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-06-24 |
|
| PDBID: | 8r0p | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-31 |
|
| PDBID: | 8yeg | | Status: | HPUB -- hold until publication | | Title: | HPV11 L1 pentamer in complex with Fab F5-187 | | Authors: | Wang, X., Fu, W. | | Deposition date: | 2024-02-22 |
|
| PDBID: | 9fif | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-29 |
|
| PDBID: | 8yeh | | Status: | HPUB -- hold until publication | | Title: | HPV16 L1 pentamer in complex with Fab F5-196 | | Authors: | Wang, X., Fu, W. | | Deposition date: | 2024-02-22 |
|
| PDBID: | 9fio | | Status: | HPUB -- hold until publication | | Title: | Structure-guided discovery of selective USP7 inhibitors with in vivo activity | | Authors: | Baker, L.M., Murray, J., Hubbard, R.E., Whitehead, N. | | Deposition date: | 2024-05-29 |
|
| PDBID: | 8r0t | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-10-31 | | Release date: | 2024-10-31 |
|
| PDBID: | 8yem | | Status: | HPUB -- hold until publication | | Title: | Tubulin-RB3_SLD-TTL in complex with compound 9 | | Authors: | Wu, C.Y., Wang, Y.X. | | Deposition date: | 2024-02-22 |
|
| PDBID: | 9fip | | Status: | HPUB -- hold until publication | | Title: | Structure-guided discovery of selective USP7 inhibitors with in vivo activity | | Authors: | Baker, L.M., Murray, J., Hubbard, R.E., Whitehead, N. | | Deposition date: | 2024-05-29 |
|
| PDBID: | 8r0c | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-31 |
|
| PDBID: | 8yet | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-23 |
|
| PDBID: | 9fih | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-29 |
|
| PDBID: | 8r0d | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of Borneoldehydrogenase ancestor N39 | | Authors: | Helmer, C.P.O., Dimos, N., Loll, B. | | Deposition date: | 2023-10-31 |
|
| PDBID: | 8yep | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-23 |
|
| PDBID: | 9fim | | Status: | HOLD -- hold until a certain date | | Title: | compound 1 bound KMT9 crystal structure | | Authors: | Sheng, W., Eric, M., Roland, S. | | Deposition date: | 2024-05-29 | | Release date: | 2025-05-29 |
|
| PDBID: | 8r0h | | Status: | HPUB -- hold until publication | | Title: | Pim1 in complex with (E)-3-(2-(thiophen-2-yl)vinyl)-3,4-dihydroquinoxalin-2(1H)-one and Pimtide | | Authors: | Hochban, P.M.M., Heine, A., Diederich, W.E. | | Deposition date: | 2023-10-31 | | Sequence: | >Entity 1
SMLLSKINSLAHLRAAPCNDLHATKLAPGKEKEPLESQYQVGPLLGSGGFGSVYSGIRVSDNLPVAIKHVEKDRISDWGELPNGTRVPMEVVLLKKVSSGFSGVIRLLDWFERPDSFVLILERPEPVQDLFDFITERGALQEELARSFFWQVLEAVRHCHNCGVLHRDIKDENILIDLNRGELKLIDFGSGALLKDTVYTDFDGTRVYSPPEWIRYHRYHGRSAAVWSLGILLYDMVCGDIPFEHDEEIIGGQVFFRQRVS(SEP)ECQHLIRWCLALRPSDRPTFEEIQNHPWMQDVLLPQETAEIHLHSLSPGPS
>Entity 2
ARKRRRHPSGPPTA
|
|
| PDBID: | 8yes | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of adenosylcobinamide kinase / adenosylcobinamide phosphate guanylyltransferase complexed with adenosylcobinamide-phosphate | | Authors: | Nam, Y., Do, H. | | Deposition date: | 2024-02-23 |
|
| PDBID: | 9fii | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-05-29 |
|
| PDBID: | 8r0q | | Status: | HPUB -- hold until publication | | Title: | Pim1 in complex with 6-bromo-1H-benzo[d]imidazol-2-amine and Pimtide | | Authors: | Hochban, P.M.M., Heine, A., Diederich, W.E. | | Deposition date: | 2023-10-31 | | Sequence: | >Entity 1
SMLLSKINSLAHLRAAPCNDLHATKLAPGKEKEPLESQYQVGPLLGSGGFGSVYSGIRVSDNLPVAIKHVEKDRISDWGELPNGTRVPMEVVLLKKVSSGFSGVIRLLDWFERPDSFVLILERPEPVQDLFDFITERGALQEELARSFFWQVLEAVRHCHNCGVLHRDIKDENILIDLNRGELKLIDFGSGALLKDTVYTDFDGTRVYSPPEWIRYHRYHGRSAAVWSLGILLYDMVCGDIPFEHDEEIIGGQVFFRQRVS(SEP)ECQHLIRWCLALRPSDRPTFEEIQNHPWMQDVLLPQETAEIHLHSLSPGPS
>Entity 2
ARKRRRHPSGPPTA
|
|
| PDBID: | 8yeq | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-23 |
|
| PDBID: | 9ftk | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of trans-o-hydroxybenzylidenepyruvate hydratase-aldolase from Pseudomonas fluorescens N3 bound to substrate intermediate | | Authors: | Milani, M., Ferrara, S. | | Deposition date: | 2024-06-24 |
|
| PDBID: | 8r0w | | Status: | HPUB -- hold until publication | | Title: | Pim1 in complex with 5-bromobenzo[d]oxazol-2-amine and Pimtide | | Authors: | Hochban, P.M.M., Heine, A., Diederich, W.E. | | Deposition date: | 2023-11-01 | | Sequence: | >Entity 1
SMLLSKINSLAHLRAAPCNDLHATKLAPGKEKEPLESQYQVGPLLGSGGFGSVYSGIRVSDNLPVAIKHVEKDRISDWGELPNGTRVPMEVVLLKKVSSGFSGVIRLLDWFERPDSFVLILERPEPVQDLFDFITERGALQEELARSFFWQVLEAVRHCHNCGVLHRDIKDENILIDLNRGELKLIDFGSGALLKDTVYTDFDGTRVYSPPEWIRYHRYHGRSAAVWSLGILLYDMVCGDIPFEHDEEIIGGQVFFRQRVS(SEP)ECQHLIRWCLALRPSDRPTFEEIQNHPWMQDVLLPQETAEIHLHSLSPGPS
>Entity 2
ARKRRRHPSGPPTA
|
|
| PDBID: | 9ftb | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-06-24 |
|
