| PDBID: | 9ij0 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-06-21 |
|
| PDBID: | 8qy8 | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-10-25 | | Release date: | 2024-10-25 |
|
| PDBID: | 9iit | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-06-21 |
|
| PDBID: | 8ydd | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-20 |
|
| PDBID: | 8qy7 | | Status: | HPUB -- hold until publication | | Title: | Zorya anti-bacteriophage defense system ZorD apo form | | Authors: | Hu, H., Taylor, N.M.I. | | Deposition date: | 2023-10-25 |
|
| PDBID: | 8ydm | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Cryo-EM structure of CaRC-LH complex from Chloroflexus aurantiacus | | Authors: | Guoqiang, H., Shishang, D. | | Deposition date: | 2024-02-20 |
|
| PDBID: | 9ij1 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-06-21 |
|
| PDBID: | 8qyc | | Status: | HPUB -- hold until publication | | Title: | Zorya anti-bacteriophage defense system ZorD in complex with ATP-gamma-S | | Authors: | Hu, H., Taylor, N.M.I. | | Deposition date: | 2023-10-25 |
|
| PDBID: | 9ij3 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-06-21 |
|
| PDBID: | 8ydc | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-20 |
|
| PDBID: | 8qyd | | Status: | HPUB -- hold until publication | | Title: | Zorya anti-bacteriophage defense system ZorAB | | Authors: | Hu, H., Taylor, N.M.I. | | Deposition date: | 2023-10-25 |
|
| PDBID: | 8ydk | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-20 |
|
| PDBID: | 9ij4 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-06-21 |
|
| PDBID: | 8qyv | | Status: | HOLD -- hold until a certain date | | Title: | SWR1-hexasome complex | | Authors: | Jalal, A.S.B., Wigley, D.B. | | Deposition date: | 2023-10-26 | | Release date: | 2024-10-26 |
|
| PDBID: | 9iiv | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-06-21 |
|
| PDBID: | 8ydn | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2024-02-21 | | Release date: | 2025-02-21 |
|
| PDBID: | 8qz0 | | Status: | HOLD -- hold until a certain date | | Title: | SWR1-hexasome-dimer complex | | Authors: | Jalal, A.S.B., Wigley, D.B. | | Deposition date: | 2023-10-26 | | Release date: | 2024-10-26 |
|
| PDBID: | 8ydz | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-21 |
|
| PDBID: | 9ij5 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-06-21 |
|
| PDBID: | 8qz5 | | Status: | HPUB -- hold until publication | | Title: | Alpha-1-antitrypsin (Tyr244Phe) in the native conformation | | Authors: | Aldobiyan, I., Lomas, D.A., Irving, J.A. | | Deposition date: | 2023-10-26 | | Sequence: | >Entity 1
MRGSHHHHHHTDPQGDAAQKTDTSHHDQDHPTFNKITPNLAEFAFSLYRQLAHQSNSTNIFFSPVSIATAFAMLSLGTKADTHDEILEGLNFNLTEIPEAQIHEGFQELLRTLNQPDSQLQLTTGNGLFLSEGLKLVDKFLEDVKKLYHSEAFTVNFGDTEEAKKQINDYVEKGTQGKIVDLVKELDRDTVFALVNYIFFKGKWERPFEVKDTEEEDFHVDQVTTVKVPMMKRLGMFNIQH(OCS)KKLSSWVLLMKFLGNATAIFFLPDEGKLQHLENELTHDIITKFLENEDRRSASLHLPKLSITGTYDLKSVLGQLGITKVFSNGADLSGVTEEAPLKLSKAVHKAVLTIDEKGTEAAGAMFLEAIPMSIPPEVKFNKPFVFLMIEQNTKSPLFMGKVVNPTQK
|
|
| PDBID: | 9iiw | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-06-21 |
|
| PDBID: | 8ydy | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-21 |
|
| PDBID: | 8qyx | | Status: | HPUB -- hold until publication | | Title: | Human 60S ribosomal subunit | | Authors: | Wiechert, F., Schacherl, M., Sprink, T. | | Deposition date: | 2023-10-26 |
|
| PDBID: | 8ydx | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-21 |
|
| PDBID: | 9iix | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-06-21 |
|
