PDBID: | 9fss | Status: | WAIT -- processing started, waiting for author input to continue processing | Deposition date: | 2024-06-21 |
|
PDBID: | 8qwj | Status: | AUTH -- processed, waiting for author review and approval | Title: | Structure of GFP variant | Authors: | Lenz, M., Fiedler, M., Bellini, D., Chin, J.W. | Deposition date: | 2023-10-19 |
|
PDBID: | 9fst | Status: | AUTH -- processed, waiting for author review and approval | Title: | Yeast 20S proteasome with human beta1i (1-51) in complex with epoxyketone inhibitor LU-001i | Authors: | Maurits, E., Huber, E.M., Dekker, P.M., Wang, X., Heinemeyer, W., Florea, B.I., Groll, M., Overkleeft, H.S. | Deposition date: | 2024-06-21 |
|
PDBID: | 8ycp | Status: | HPUB -- hold until publication | Title: | structure of human trpv1 in complex with BC5 | Authors: | Ke, B.W., Hu, S.L. | Deposition date: | 2024-02-18 |
|
PDBID: | 8qx1 | Status: | HPUB -- hold until publication | Deposition date: | 2023-10-20 |
|
PDBID: | 8ycv | Status: | HPUB -- hold until publication | Deposition date: | 2024-02-18 |
|
PDBID: | 9fsu | Status: | AUTH -- processed, waiting for author review and approval | Title: | Yeast 20S proteasome with human beta1i (1-51) in complex with epoxyketone inhibitor 42 | Authors: | Maurits, E., Huber, E.M., Dekker, P.M., Wang, X., Heinemeyer, W., Florea, B.I., Groll, M., Overkleeft, H.S. | Deposition date: | 2024-06-21 |
|
PDBID: | 8qww | Status: | HPUB -- hold until publication | Title: | Structure of the amyloid-forming peptide LYIQWL from Tc5b, grown from 10% ethanol without TFA | Authors: | Durvanger, Z. | Deposition date: | 2023-10-20 |
|
PDBID: | 9fsi | Status: | HPUB -- hold until publication | Title: | NMR solution structure of synthetic hexapeptide | Authors: | Geyer, A., Vazquez, O. | Deposition date: | 2024-06-21 |
|
PDBID: | 8ycy | Status: | HPUB -- hold until publication | Title: | CryoEM structure of M. tuberculosis ClpC1P1P2 complex bound to bortezomib, conformation 3 | Authors: | Zhou, B., Gao, Y., Zhao, H., Chen, X., He, J., Zhang, T., Xiong, X. | Deposition date: | 2024-02-18 |
|
PDBID: | 8qwv | Status: | HPUB -- hold until publication | Title: | Structure of the amyloid-forming peptide LYIQNL, grown in the presence of ethanol | Authors: | Durvanger, Z. | Deposition date: | 2023-10-20 |
|
PDBID: | 8ycx | Status: | HPUB -- hold until publication | Title: | CryoEM structure of M. tuberculosis ClpC1P1P2 complex bound to bortezomib, conformation 2 | Authors: | Zhou, B., Gao, Y., Zhao, H., Chen, X., He, J., Zhang, T., Xiong, X. | Deposition date: | 2024-02-18 |
|
PDBID: | 9fsh | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2024-06-21 |
|
PDBID: | 8qwu | Status: | HPUB -- hold until publication | Title: | Structure of the amyloid-forming peptide LYIQNL, grown without ethanol | Authors: | Durvanger, Z. | Deposition date: | 2023-10-20 |
|
PDBID: | 9fsj | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2024-06-21 |
|
PDBID: | 8yd0 | Status: | HPUB -- hold until publication | Title: | CryoEM structure of M. tuberculosis ClpXP1P2 complex bound to bortezomib | Authors: | Zhou, B., Gao, Y., Zhao, H., Chen, X., He, J., Zhang, T., Xiong, X. | Deposition date: | 2024-02-18 |
|
PDBID: | 8qx3 | Status: | HPUB -- hold until publication | Deposition date: | 2023-10-21 |
|
PDBID: | 8ycw | Status: | HPUB -- hold until publication | Deposition date: | 2024-02-18 |
|
PDBID: | 9fsk | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2024-06-21 |
|
PDBID: | 8qx4 | Status: | HPUB -- hold until publication | Deposition date: | 2023-10-22 |
|
PDBID: | 9iiu | Status: | HPUB -- hold until publication | Title: | Cryo-EM structure of an TEF30-associated intermediate PSII core complex from Chlamydomonas reinhardtii | Authors: | Wang, Y., Wang, C., Li, A., Liu, Z. | Deposition date: | 2024-06-21 |
|
PDBID: | 8qx6 | Status: | HPUB -- hold until publication | Title: | Novel laminarin-binding CBM X584 | Authors: | Zuehlke, M.K., Jeudy, A., Czjzek, M. | Deposition date: | 2023-10-22 | Sequence: | >Entity 1 DFALPINFGADIEYTTGANSVPFEVVTNPEQSGINATDTKVGKVTNQGGQYEALTFLLDEAIDFSGSNKTITMKVYSEVAYQVLFKLETGMNGERANEVEVSHSGNGWEELSFNFNNARNSFVQGDDANNGQPFVPTGQYDEISIFLDFAGFTAGDFYIDDIEQN
|
|
PDBID: | 9iiq | Status: | AUTH -- processed, waiting for author review and approval | Title: | Crystal structure of 117 Fab-E complex | Authors: | Zhao, H., Deng, Z. | Deposition date: | 2024-06-21 |
|
PDBID: | 8yda | Status: | HPUB -- hold until publication | Deposition date: | 2024-02-19 |
|
PDBID: | 9iio | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2024-06-21 |
|