| PDBID: | 8qp3 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-29 |
|
| PDBID: | 8y8q | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-06 |
|
| PDBID: | 9fqn | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of phosphoserine phosphatase (SerB) from Brucella melitensis in complex with L-Ser and Magnesium | | Authors: | Scaillet, T., Wouters, J. | | Deposition date: | 2024-06-17 |
|
| PDBID: | 8qp4 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-29 |
|
| PDBID: | 8y8r | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-06 |
|
| PDBID: | 9fqk | | Status: | WAIT -- processing started, waiting for author input to continue processing | | Title: | Perkinsus marinus Respiratory complex II soluble region | | Authors: | Wu, F., Amunts, A. | | Deposition date: | 2024-06-17 |
|
| PDBID: | 8qp6 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of Hepatitis C Virus E1 glycoprotein epitope 314-324 scaffold design 1W4K_08 in complex with neutralizing antibody F(ab) fragment IGH526 | | Authors: | Nagarathinam, K., Krey, T. | | Deposition date: | 2023-09-30 | | Sequence: | >Entity 1
MGSREVATPHRAAWLAMMLGIDASKVKGTGPGGVITVEDVKRWAEETAKATAGSENLYFQ
>Entity 2
EVQLLEQSGAEVKRPGASVKVSCKASGYTFTSYAIHWVRQAPGQRLEWMGWINPGNGNAKYSQRFQGRVIISRDTSATTSYMELSSLTSEDTAVYSCARDRGFDLLTGHYLGLDPWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCGSLEDDDDKAGWSHPQFEKGGGSGGGSGGGSWSHPQFEKEIELTLTQPASASATPGQRVTISCSGSSSNIGGNTVNWYQHLPGAAPKLLIHNNDLRPSGVPDRFSGSKSGTSASLAVSGLQSEDEADYFCAAWDDGLNGWVFGGGTKLTVLGQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHKSYSCQVTHEGSTVEKTVAPTECS
|
|
| PDBID: | 8y8s | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-06 |
|
| PDBID: | 9fqz | | Status: | HPUB -- hold until publication | | Title: | CRYO-EM STRUCTURE OF HCT15 POLYSOMES BOUND TO EEF2, EBP1, AND SERBP1 | | Authors: | Rajan, K.S., Yonath, A. | | Deposition date: | 2024-06-17 |
|
| PDBID: | 8qp7 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of Hepatitis C Virus E2 glycoprotein epitopeI 411-424 scaffold design 4CIL_04 | | Authors: | Nagarathinam, K., Cramer, J.T., Krey, T. | | Deposition date: | 2023-09-30 |
|
| PDBID: | 8y8w | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-06 |
|
| PDBID: | 9fqs | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-06-17 |
|
| PDBID: | 8qpo | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-02 |
|
| PDBID: | 8y8x | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-06 |
|
| PDBID: | 9fqp | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-06-17 |
|
| PDBID: | 8qpg | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-02 |
|
| PDBID: | 8y9h | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the C terminal domain of EF-hand domain-containing protein 1 | | Authors: | Chueh, C.K., Wei, J.H. | | Deposition date: | 2024-02-06 |
|
| PDBID: | 9fqm | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2024-06-17 | | Release date: | 2025-06-17 |
|
| PDBID: | 8qpq | | Status: | HPUB -- hold until publication | | Title: | C1 turret to baseplate interface of full Haloferax tailed virus 1 adjacent to the portal-capsid interface. | | Authors: | Zhang, D., Daum, B., Isupov, M.N., McLaren, M. | | Deposition date: | 2023-10-02 |
|
| PDBID: | 8y8e | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-06 |
|
| PDBID: | 9fql | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of hDM2 in complex with a peptidic ligand containing a di-urea insert. | | Authors: | Buratto, J., Mauran, L., Goudreau, S., Guichard, G. | | Deposition date: | 2024-06-17 |
|
| PDBID: | 8qpv | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-03 |
|
| PDBID: | 8y8m | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-06 |
|
| PDBID: | 9fqt | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of MmCAT1 bound with FrMLV-RBD in the apo inward-open state | | Authors: | Ye, M., Zhou, D., Pike, A.C.W., Wang, S., Wang, D., Bakshi, S., Brooke, L., Williams, E., Elkins, J., Stuart, D.I., Sauer, D.B. | | Deposition date: | 2024-06-17 |
|
| PDBID: | 8qq2 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2023-10-03 |
|
