| PDBID: | 8z80 | | Status: | HOLD -- hold until a certain date | | Title: | SLC19A2-Pyridoxine inward structure | | Authors: | Li, P.P., Zhu, Z.N., Wang, Y., Gao, P., Qu, Q.H. | | Deposition date: | 2024-04-21 | | Release date: | 2025-04-21 |
|
| PDBID: | 9ft6 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-06-24 |
|
| PDBID: | 9ft5 | | Status: | HPUB -- hold until publication | | Title: | 25-hydroxy steroid kinase (25-HSK) + ADP + 25-phospho-cholest-1,4-diene-3-one | | Authors: | Ermler, U., Boll, M., Demmer, U., Warkentin, E., Jacoby, C. | | Deposition date: | 2024-06-24 |
|
| PDBID: | 8z7y | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2024-04-21 | | Release date: | 2025-04-21 |
|
| PDBID: | 9ft4 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-06-24 |
|
| PDBID: | 8qtv | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-13 |
|
| PDBID: | 8z7s | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2024-04-21 | | Release date: | 2025-04-21 |
|
| PDBID: | 9ft8 | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2024-06-24 | | Release date: | 2024-12-24 |
|
| PDBID: | 8qtr | | Status: | HOLD -- hold until a certain date | | Title: | Cryo-EM structure of the FB-bound yeast Ceramide Synthase | | Authors: | Schaefer, J., Clausmeyer, L., Koerner, C., Moeller, A., Froehlich, F. | | Deposition date: | 2023-10-13 | | Release date: | 2024-10-13 |
|
| PDBID: | 9ft3 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-06-24 |
|
| PDBID: | 8qtu | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of human Sirt2 in complex with the super-slow substrate TNFn-3 and NAD+ | | Authors: | Friedrich, F., Kalbas, D., Meleshin, M., Einsle, O., Schutkowski, M., Jung, M. | | Deposition date: | 2023-10-13 |
|
| PDBID: | 8z86 | | Status: | HPUB -- hold until publication | | Title: | BA.5 RBD in complex with CR9 | | Authors: | Feng, L.L. | | Deposition date: | 2024-04-21 |
|
| PDBID: | 9ft2 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-06-24 |
|
| PDBID: | 8qtz | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM reconstruction of VP5*/VP8* assembly from SA11 Rotavirus Tripsinized Triple Layered Particle | | Authors: | Asensio-Cob, D., Perez-Mata, C., Gomez-Blanco, J., Vargas, J., Rodriguez, J.M., Luque, D. | | Deposition date: | 2023-10-13 |
|
| PDBID: | 9ftk | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of trans-o-hydroxybenzylidenepyruvate hydratase-aldolase from Pseudomonas fluorescens N3 bound to substrate intermediate | | Authors: | Milani, M., Ferrara, S. | | Deposition date: | 2024-06-24 |
|
| PDBID: | 8z8l | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2024-04-22 | | Release date: | 2025-04-22 |
|
| PDBID: | 9ftb | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-06-24 |
|
| PDBID: | 8qu6 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-13 |
|
| PDBID: | 8z95 | | Status: | HPUB -- hold until publication | | Title: | Humanized anti-PEG h6.3 Fab in complex with PEG | | Authors: | Lin, Y.C., Chang, C.Y., Su, Y.C. | | Deposition date: | 2024-04-22 |
|
| PDBID: | 9ftl | | Status: | HPUB -- hold until publication | | Title: | Asgard ESCRT-IIIB filament structure | | Authors: | Chaaban, S., Souza, D.P., Baum, B. | | Deposition date: | 2024-06-24 |
|
| PDBID: | 8qun | | Status: | HPUB -- hold until publication | | Title: | human carbonic anhydrase I in complex with 2-((5-cyano-4-hydroxy-6-(p-tolyl)pyrimidin-2-yl)thio)-N-(4-sulfamoylphenyl)acetamide | | Authors: | Angeli, A., Ferraroni, M. | | Deposition date: | 2023-10-16 | | Sequence: | >Entity 1
MASPDWGYDDKNGPEQWSKLYPIANGNNQSPVDIKTSETKHDTSLKPISVSYNPATAKEIINVGHSFHVNFEDNDNRSVLKGGPFSDSYRLFQFHFHWGSTNEHGSEHTVDGVKYSAELHVAHWNSAKYSSLAEAASKADGLAVIGVLMKVGEANPKLQKVLDALQAIKTKGKRAPFTNFDPSTLLPSSLDFWTYPGSLTHPPLYESVTWIICKESISVSSEQLAQFRSLLSNVEGDNAVPMQHNNRPTQPLKGRTVRASF
|
|
| PDBID: | 8z8f | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-22 |
|
| PDBID: | 9ftm | | Status: | HPUB -- hold until publication | | Title: | Asgard ESCRT-IIIB membrane-bound protofilament structure | | Authors: | Chaaban, S., Souza, D.P., Baum, B. | | Deposition date: | 2024-06-24 |
|
| PDBID: | 8qut | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of the heat-irreversible amyloid fibrils of human lysozyme | | Authors: | Frey, L., Greenwald, J., Riek, R. | | Deposition date: | 2023-10-17 | | Sequence: | >Entity 1
KVFERCELARTLKRLGMDGYRGISLANWMCLAKWESGYNTRATNYNAGDRSTDYGIFQINSRYWCNDGKTPGAVNACHLSCSALLQDNIADAVACAKRVVRDPQGIRAWVAWRNRCQNRDVRQYVQGCGV
>Entity 2
(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)
|
|
| PDBID: | 8z8q | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-22 |
|
