PDBID: | 8q51 | Status: | HPUB -- hold until publication | Deposition date: | 2023-08-07 |
|
PDBID: | 8ymi | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2024-03-09 |
|
PDBID: | 8q4y | Status: | HPUB -- hold until publication | Deposition date: | 2023-08-07 |
|
PDBID: | 8yme | Status: | HPUB -- hold until publication | Deposition date: | 2024-03-09 |
|
PDBID: | 9flg | Status: | HPUB -- hold until publication | Title: | Solution NMR structure of the Delta60 domain of the hepatitis delta virus small antigen SHDAg | Authors: | Yang, Y., Delcourte, L., Fogeron, M.L., Bockmann, A., Lecoq, L. | Deposition date: | 2024-06-05 |
|
PDBID: | 9flr | Status: | AUTH -- processed, waiting for author review and approval | Title: | Crystal structure of human Haspin (GSG2) kinase bound to MU1963 | Authors: | Kraemer, A., Paruch, K., Knapp, S., Structural Genomics Consortium (SGC) | Deposition date: | 2024-06-05 |
|
PDBID: | 8q4s | Status: | HPUB -- hold until publication | Title: | Crystal structure of phosphoserine phosphatase (SerB) from Brucella melitensis in complex with AP4 and magnesium. | Authors: | Scaillet, T., Wouters, J. | Deposition date: | 2023-08-07 |
|
PDBID: | 8ymd | Status: | HPUB -- hold until publication | Title: | Galectin-3 with lychnose | Authors: | Su, J.Y. | Deposition date: | 2024-03-09 |
|
PDBID: | 9flq | Status: | AUTH -- processed, waiting for author review and approval | Title: | Crystal structure of human Haspin (GSG2) kinase bound to MU1959 | Authors: | Kraemer, A., Paruch, K., Knapp, S., Structural Genomics Consortium (SGC) | Deposition date: | 2024-06-05 |
|
PDBID: | 8q53 | Status: | HPUB -- hold until publication | Title: | Crystal structure of truncated human Microtubule-associated proteins 1A/1B light chain 3B (MAP1LC3B) in apo form | Authors: | Kumar, A., Knapp, S., Structural Genomics Consortium (SGC) | Deposition date: | 2023-08-08 |
|
PDBID: | 8ymm | Status: | AUTH -- processed, waiting for author review and approval | Title: | OSCA1.1-F516A open | Authors: | Zhang, M.F. | Deposition date: | 2024-03-09 | Release date: | 2025-03-09 |
|
PDBID: | 9flo | Status: | AUTH -- processed, waiting for author review and approval | Title: | Crystal structure of human Haspin (GSG2) kinase bound to MU2181 | Authors: | Kraemer, A., Paruch, K., Knapp, S., Structural Genomics Consortium (SGC) | Deposition date: | 2024-06-05 |
|
PDBID: | 8kdi | Status: | HPUB -- hold until publication | Deposition date: | 2023-08-09 |
|
PDBID: | 8ymn | Status: | AUTH -- processed, waiting for author review and approval | Title: | OSCA1.1-F516A pre-open 2 | Authors: | Zhang, M.F. | Deposition date: | 2024-03-09 | Release date: | 2025-03-09 |
|
PDBID: | 9fm3 | Status: | HPUB -- hold until publication | Title: | KlenTaq DNA polymerase in a ternary complex with primer/template and a selenophene-modified dUTP (SedUTP) | Authors: | Betz, K., Srivatsan, S.G. | Deposition date: | 2024-06-05 |
|
PDBID: | 8kcj | Status: | HPUB -- hold until publication | Title: | De novo design protein -N7 | Authors: | Wang, S., Liu, Y. | Deposition date: | 2023-08-07 |
|
PDBID: | 8ymo | Status: | AUTH -- processed, waiting for author review and approval | Title: | OSCA1.1-F516A pre-open 1 | Authors: | Zhang, M.F. | Deposition date: | 2024-03-09 | Release date: | 2025-03-09 |
|
PDBID: | 9flh | Status: | HPUB -- hold until publication | Deposition date: | 2024-06-05 |
|
PDBID: | 8kck | Status: | HPUB -- hold until publication | Title: | De novo design protein -N9 | Authors: | Wang, S., Liu, Y. | Deposition date: | 2023-08-07 | Sequence: | >Entity 1 GAEAAAAAAVTAELRAFRAAGGTVELEDLPVTPETLARAEAALARLPPESVAVETYTVPAPTPEAFLAALEAALARLAAEGLPAILLRVVDADGNLVGSILVAAAGPPAESAAATGRVLTIYVASSPEGLKVARGLAIETRDAGGLALAIGASGAWALAGLAGALALARRLAEAHGAPVRVVTIGDPANPTDAALAAAIRAAYAAALEHHHHHH
|
|
PDBID: | 8ymp | Status: | AUTH -- processed, waiting for author review and approval | Title: | OSCA1.1-F516A nanodisc in LPC | Authors: | Zhang, M.F. | Deposition date: | 2024-03-09 | Release date: | 2025-03-09 |
|
PDBID: | 9flj | Status: | HPUB -- hold until publication | Title: | Crystal structure of the C-terminal domain of VldE from Streptococcus pneumoniae containing three zinc atoms at the binding site | Authors: | Acebron, I., Miguel-Ruano, V., Hermoso, J.A. | Deposition date: | 2024-06-05 |
|
PDBID: | 8q86 | Status: | HPUB -- hold until publication | Deposition date: | 2023-08-18 | Release date: | 2025-02-18 |
|
PDBID: | 8ymq | Status: | AUTH -- processed, waiting for author review and approval | Title: | OSCA1.1-F516A nanodisc | Authors: | Zhang, M.F. | Deposition date: | 2024-03-09 | Release date: | 2025-03-09 |
|
PDBID: | 9flk | Status: | HPUB -- hold until publication | Title: | Crystal structure of the C-terminal domain of VldE from Streptococcus pneumoniae containing two zinc atoms at the binding site | Authors: | Acebron, I., Miguel-Ruano, V., Hermoso, J.A. | Deposition date: | 2024-06-05 |
|
PDBID: | 8kgb | Status: | HPUB -- hold until publication | Deposition date: | 2023-08-18 |
|