| PDBID: | 8ptd | | Status: | HPUB -- hold until publication | | Title: | The surface-exposed lipo-protein of BtuG1 in complex with cyanocobalamin. | | Authors: | Whittaker, J., Felices Martinez, J.M., Guskov, A., Slotboom, D.J. | | Deposition date: | 2023-07-14 |
|
| PDBID: | 9f5p | | Status: | HPUB -- hold until publication | | Title: | Poliovirus type 2 (strain MEF-1) stabilised virus-like particle (PV2 SC6b) from an insect cell expression system. | | Authors: | Bahar, M.W., Porta, C., Fry, E.E., Stuart, D.I. | | Deposition date: | 2024-04-29 |
|
| PDBID: | 8xf5 | | Status: | HOLD -- hold until a certain date | | Title: | Crystal structure of 5-aminoimidazole ribonucleotide (AIR) synthetase from Pyrococcus horikoshii with ADP | | Authors: | Chen, Y.H., Chen, C.J. | | Deposition date: | 2023-12-13 | | Release date: | 2024-12-13 |
|
| PDBID: | 9f5s | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-30 |
|
| PDBID: | 8xfe | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of defence-associated sirtuin 2 (DSR2) H171A protein in complex with DSR anti-defence 1(DSAD1) | | Authors: | Li, Y., Zhang, H., Zheng, Q., Wu, Y., Li, S. | | Deposition date: | 2023-12-13 |
|
| PDBID: | 8pts | | Status: | HPUB -- hold until publication | | Title: | human GUK1 in complex with compound AT8001 | | Authors: | Zimberger, C., Canard, B., Ferron, F. | | Deposition date: | 2023-07-14 | | Sequence: | >Entity 1
MSGPRPVVLSGPSGAGKSTLLKRLLQEHSGIFGFSVSHTTRNPRPGEENGKDYYFVTREVMQRDIAAGDFIEHAEFSGNLYGTSKVAVQAVQAMNRICVLDVDLQGVRNIKATDLRPIYISVQPPSLHVLEQRLRQRNTETEESLVKRLAAAQADMESSKEPGLFDVVIINDSLDQAYAELKEALSEEIKKAQRTGA
|
|
| PDBID: | 9f6a | | Status: | HPUB -- hold until publication | | Title: | EVA71 E096A native particle | | Authors: | Kingston, N.J., Stonehouse, N.J., Rowlands, D.J., Hogle, J.M., Filman, D.J., Snowden, J.S.S. | | Deposition date: | 2024-04-30 |
|
| PDBID: | 8xew | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of defence-associatedsirtuin 2 (DSR2) H171A protein | | Authors: | Li, Y., Zhang, H., Zheng, Q., Wu, Y., Li, S. | | Deposition date: | 2023-12-13 |
|
| PDBID: | 8ptt | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-07-14 |
|
| PDBID: | 9f5r | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-30 | | Sequence: | >Entity 1
MGSSHHHHHHSAALEVLFQGPHMWTISKEYHIDEEVGFALPNPQENLPDFYNDWMFIAKHLPDLIESGQLRERVEKLNMLSIDHLTDHKSQRLARLVLGCITMAYVWGKGHGDVRKVLPRNIAVPYCQLSKKLELPPILVYADCVLANWKKKDPNKPLTYENMDVLFSFRDGDCSKGFFLVSLLVEIAAASAIKVIPTVFKAMQMQERDTLLKALLEIASCLEKALQVFHQIHDHVNPKAFFSVLRIYLSGWKGNPQLSDGLVYEGFWEDPKEFAGGSAGQSSVFQCFDVLLGIQQTAGGGHAAQFLQDMRRYMPPAHRNFLCSLESNPSVREFVLSKGDAGLREAYDACVKALVSLRSYHLQIVTKYILIPASQQPKENKTSEDPSKLEAKGTGGTDLMNFLKTVRSTTEKSLLKEG
|
|
| PDBID: | 8xff | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of defence-associatedsirtuin 2 (DSR2) H171A protein in complex with SPR phage tail tube protein | | Authors: | Li, Y., Zhang, H., Zheng, Q., Wu, Y., Li, S. | | Deposition date: | 2023-12-13 |
|
| PDBID: | 8k32 | | Status: | HPUB -- hold until publication | | Title: | The complex structure of SLKARI with NADH at 2.12-angstrom resolution | | Authors: | Chen, C.Y., Huang, C.H. | | Deposition date: | 2023-07-14 |
|
| PDBID: | 9f5t | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-30 |
|
| PDBID: | 8xfc | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of the ATP-bound Mtb DppABCD with the D445A mutation of DppA | | Authors: | Hu, T., Zhang, B., Rao, Z. | | Deposition date: | 2023-12-13 |
|
| PDBID: | 8k30 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-07-14 | | Release date: | 2025-01-14 |
|
| PDBID: | 9f5x | | Status: | PROC -- to be processed | | Deposition date: | 2024-04-30 |
|
| PDBID: | 8xet | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-13 |
|
| PDBID: | 8k2z | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-07-14 | | Release date: | 2025-01-14 |
|
| PDBID: | 9f5y | | Status: | WAIT -- processing started, waiting for author input to continue processing | | Deposition date: | 2024-04-30 |
|
| PDBID: | 8xeu | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-13 |
|
| PDBID: | 8k3a | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-07-14 |
|
| PDBID: | 9f5z | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-30 |
|
| PDBID: | 8xf7 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-13 |
|
| PDBID: | 8ptv | | Status: | HPUB -- hold until publication | | Title: | IPNS variant N252Q in complex with Fe and ACV under anaerobic conditions | | Authors: | Rabe, P., Schofield, C.J. | | Deposition date: | 2023-07-15 |
|
| PDBID: | 9f60 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-30 |
|
