| PDBID: | 8xte | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-10 | | Sequence: | >Entity 1
GAMGAASPASIIQELASAAKQYENNESGAREALIAQSRALIASLEVPSEFIQHTFWSQPALSAIVRLATDVNLFQYLKDAQEEGLNAEALASKTGMDVSLFARLARHLVAMNVITSRNGVFYGTALSNGLAAENYQQSIRFCHDVSRPSFGAFPSFFKGNGYKTPALGTTDGPFQSAHKVDISFPQWLVGNPPYLQYFNSYMSAYRAGKPNWCDNGFYPVADRLLNGFDASVSDVLLVDVGGGRGHDIATFGSQFSPLPGRLVLQDREQVINSIPADESRQFEATTHDIFTTQPVKHARAYYMHSVPHGFGDEDAVKIMANLVPALAKGYSRVLLNEIVVDEERPVMSATNMDLIMLAHMGAKERTEADWRSILTRAGLKVVNIYSYPGVAESLIEAELA
|
|
| PDBID: | 9exv | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-04-08 |
|
| PDBID: | 8xt7 | | Status: | HPUB -- hold until publication | | Title: | The crystal structure of human AS3MT | | Authors: | Chun, I.S., Kim, M.S. | | Deposition date: | 2024-01-10 |
|
| PDBID: | 9exn | | Status: | WAIT -- processing started, waiting for author input to continue processing | | Title: | The vaccinia minimal RNA polymerase cryo EM structure at 1.9A resolution | | Authors: | Grimm, C., Jungwirth, S., Fischer, U. | | Deposition date: | 2024-04-08 |
|
| PDBID: | 8oxz | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-05-03 | | Release date: | 2024-11-03 |
|
| PDBID: | 8xt5 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-10 |
|
| PDBID: | 9exk | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-08 |
|
| PDBID: | 8xtc | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-10 |
|
| PDBID: | 9exf | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of Yeast Clathrin Heavy Chain N-terminal domain bound to YAP1801 peptide (LIDM) | | Authors: | Defelipe, L.A., Bento, I., Garcia Alai, M.M. | | Deposition date: | 2024-04-08 |
|
| PDBID: | 8xt6 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-10 |
|
| PDBID: | 8oyj | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-05-05 | | Release date: | 2024-11-05 |
|
| PDBID: | 9exu | | Status: | HPUB -- hold until publication | | Title: | Complex of a mutant of the SARS-CoV-2 main protease Mpro with the nsp4/5 substrate peptide (cocrystallization). | | Authors: | Battistutta, R., Fornasier, E., Giachin, G. | | Deposition date: | 2024-04-08 |
|
| PDBID: | 8xt8 | | Status: | HPUB -- hold until publication | | Title: | Clostridioides difficile MarR (WP_003434724) with Hg-bound | | Authors: | Park, S., Kwon, N. | | Deposition date: | 2024-01-10 |
|
| PDBID: | 8p13 | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of Rhodopsin-Gi bound with antibody fragments scFv16 and Fab79, conformation 1 | | Authors: | Pamula, F., Tejero, O., Muehle, J., Thoma, R., Schertler, G.F.X., Marino, J., Tsai, C.-J. | | Deposition date: | 2023-05-11 | | Release date: | 2024-11-11 |
|
| PDBID: | 9ext | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of Yeast Clathrin Heavy Chain N-terminal domain bound to APL2/AP-1 Beta peptide (LLDL) | | Authors: | Defelipe, L.A., Bento, I., Garcia Alai, M.M. | | Deposition date: | 2024-04-08 |
|
| PDBID: | 8p15 | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of Rhodopsin-Gi bound with antibody fragments scFv16 and Fab79, conformation 2 | | Authors: | Pamula, F., Tejero, O., Muehle, J., Thoma, R., Schertler, G.F.X., Marino, J., Tsai, C.-J. | | Deposition date: | 2023-05-11 | | Release date: | 2024-11-11 |
|
| PDBID: | 8xtl | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-11 |
|
| PDBID: | 9eyi | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-09 |
|
| PDBID: | 8xtt | | Status: | HOLD -- hold until a certain date | | Title: | Nuclear receptor Nor1 ligand binding domain | | Authors: | Yoo, J.Y., Yoon, H.S. | | Deposition date: | 2024-01-11 | | Release date: | 2025-01-11 | | Sequence: | >Entity 1
KSPLQQEPSQPSPPSPPICMMNALVRALTDSTPRDLDYSRYCPTDQAAAGTDAEHVQQFYNLLTASIDVSRSWAEKIPGFTDLPKEDQTLLIESAFLELFVLRLSIRSNTAEDKFVFCNGLVLHRLQCLRGFGEWLDSIKDFSLNLQSLNLDIQALACLSALSMITERHGLKEPKRVEELCNKITSSLKDHQSKGQALEPTESKVLGALVELRKICTLGLQRIFYLKLEDLVSPPSIIDKLFLDTLPF
|
|
| PDBID: | 8p3i | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2023-05-17 | | Release date: | 2024-11-17 |
|
| PDBID: | 9eyj | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-09 |
|
| PDBID: | 8xto | | Status: | HOLD -- hold until a certain date | | Title: | Human Keratin 19 head domain segment L18-G38 in solution | | Authors: | Jeong, M., Ji, Y., Kim, J., Lee, C.H. | | Deposition date: | 2024-01-11 | | Release date: | 2025-01-11 | | Sequence: | >Entity 1
LGGGSVRFGPGVAFRAPSIHG
|
|
| PDBID: | 8p3j | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2023-05-17 | | Release date: | 2024-11-17 |
|
| PDBID: | 9eyk | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-09 |
|
| PDBID: | 8xtn | | Status: | HOLD -- hold until a certain date | | Title: | Human Keratin 19 head domain segment Y6-G38 in solution | | Authors: | Jeong, M., Ji, Y., Kim, J., Lee, C.H. | | Deposition date: | 2024-01-11 | | Release date: | 2025-01-11 | | Sequence: | >Entity 1
YRQSSATSSFGGLGGGSVRFGPGVAFRAPSIHG
|
|
