| PDBID: | 7gvu | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-01-09 |
|
| PDBID: | 9bd2 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | MAGE-A3 MHD crystal soaked with KL861 | | Authors: | Butrin, A., Crews, C. | | Deposition date: | 2024-04-10 |
|
| PDBID: | 8vb7 | | Status: | HPUB -- hold until publication | | Title: | Kinetic intermediate states of HIV-1 RT DNA synthesis captured by cryo-EM | | Authors: | Vergara, S., Zhou, X., Santiago, U., Conway, J.F., Sluis-Cremer, N., Calero, G. | | Deposition date: | 2023-12-12 |
|
| PDBID: | 7gvv | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-01-09 |
|
| PDBID: | 9bdg | | Status: | HPUB -- hold until publication | | Title: | Influenza A virus Hemagglutinin H3/Darwin/6/2021 in complex with Fab ADI-85647 | | Authors: | Ferreira Ramos, A.S., Bajic, G. | | Deposition date: | 2024-04-11 |
|
| PDBID: | 8vbh | | Status: | HPUB -- hold until publication | | Title: | Kinetic intermediate states of HIV-1 RT DNA synthesis captured by cryo-EM | | Authors: | Vergara, S., Zhou, X., Santiago, U., Conway, J.F., Sluis-Cremer, N., Calero, G. | | Deposition date: | 2023-12-12 |
|
| PDBID: | 7gvw | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-01-09 |
|
| PDBID: | 9bdf | | Status: | HPUB -- hold until publication | | Title: | Influenza A virus Hemagglutinin H3/Darwin/6/2021 in complex with Fab ADI-85666 | | Authors: | Ferreira Ramos, A.S., Bajic, G. | | Deposition date: | 2024-04-11 |
|
| PDBID: | 8vb9 | | Status: | HPUB -- hold until publication | | Title: | Kinetic intermediate states of HIV-1 RT DNA synthesis captured by cryo-EM | | Authors: | Vergara, S., Zhou, X., Santiago, U., Conway, J.F., Sluis-Cremer, N., Calero, G. | | Deposition date: | 2023-12-12 |
|
| PDBID: | 7gvx | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-01-09 |
|
| PDBID: | 9bd9 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | SARS CoV-2 full-length spike protein, 1RBD-up conformation | | Authors: | Singh, S., Hasan, S.S. | | Deposition date: | 2024-04-11 |
|
| PDBID: | 8vbg | | Status: | HPUB -- hold until publication | | Title: | Kinetic intermediate states of HIV-1 RT DNA synthesis captured by cryo-EM | | Authors: | Vergara, S., Zhou, X., Santiago, U., Conway, J.F., Sluis-Cremer, N., Calero, G. | | Deposition date: | 2023-12-12 |
|
| PDBID: | 7gvy | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-01-09 |
|
| PDBID: | 9bd5 | | Status: | HPUB -- hold until publication | | Title: | Laccase from Bacillus licheniformis | | Authors: | Habib, M.H., Smith, T.J. | | Deposition date: | 2024-04-11 | | Sequence: | >Entity 1
MKLEKFVDKLPIPKVLKPHSKSKEMTYYEVTMKEFQQQLHRDLPPTRLFGYNGVYPGPTFEVQKHEKVAVKWLNKLPDHHFLPVDHTIHDDGHHEHEVKTVVHLHGGRTPPDSDGYPEAWYTKDFQVKGPFFEREVYEYPNEQDATALWYHDHAMAITRLNVYAGLVGLYFIRDREERSLNLPKGEYEIPLLIQDKSFHEDGSLFYPRQPDNPSPDLPDPSIVPAFCGDTILVNGKVWPYDELEPRKYRFRILNASNTRIFELYFDHDITFHQIGTDGGLLQHPVKVNELVIAPAERCDIIVDFSRAEGKTVTLKNRIGCSGQDADPDTDANIMQFRISKPLKQKDTSSLPRILRKRPFYRRHKINTLRNLSLGASLDQYGRPVLLLNNTKWHEPVTETPALGSTEIWSIINAGRAIHPIHLHLVQFLILDHRPFDIERYQENGELVFTGPAAPPAQNEKGLKDTVKVPPGSVTRIIATFAPYSGRYVWHCHILEHEDYDMMRPLEVTDIRHQEFEAWARTKTHLRRGSE
|
|
| PDBID: | 8vbc | | Status: | HPUB -- hold until publication | | Title: | Kinetic intermediate states of HIV-1 RT DNA synthesis captured by cryo-EM | | Authors: | Vergara, S., Zhou, X., Santiago, U., Conway, J.F., Sluis-Cremer, N., Calero, G. | | Deposition date: | 2023-12-12 |
|
| PDBID: | 7gvz | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-01-09 |
|
| PDBID: | 9bdb | | Status: | HPUB -- hold until publication | | Title: | Bacillus anthracis BxpB homotrimer in complex with BclA NTD peptide | | Authors: | Schormann, N., Green, T., Turnbough, C.L. | | Deposition date: | 2024-04-11 | | Sequence: | >Entity 1
MFSSDCEFTKIDCEAKPASTLPAFGFAFNASAPQFASLFTPLLLPSVSPNPNITVPVINDTVSVGDGIRILRAGIYQISYTLTISLDNSPVAPEAGRFFLSLGTPANIIPGSGTAVRSNVIGTGEVDVSSGVILINLNPGDLIRIVPVELIGTVDIRAAALTVAQIS
>Entity 2
AFDPNLVGPTLPPIPPFTL
|
|
| PDBID: | 8vbi | | Status: | HPUB -- hold until publication | | Title: | Kinetic intermediate states of HIV-1 RT DNA synthesis captured by cryo-EM | | Authors: | Vergara, S., Zhou, X., Santiago, U., Conway, J.F., Sluis-Cremer, N., Calero, G. | | Deposition date: | 2023-12-12 |
|
| PDBID: | 7gw0 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-01-09 |
|
| PDBID: | 9bda | | Status: | HPUB -- hold until publication | | Title: | Bacillus anthracis BxpB homotrimer in complex with BclA NTD peptide | | Authors: | Schormann, N., Green, T., Turnbough, C.L. | | Deposition date: | 2024-04-11 | | Sequence: | >Entity 1
MFSSDCEFTKIDCEAKPASTLPAFGFAFNASAPQFASLFTPLLLPSVSPNPNITVPVINDTVSVGDGIRILRAGIYQISYTLTISLDNSPVAPEAGRFFLSLGTPANIIPGSGTAVRSNVIGTGEVDVSSGVILINLNPGDLIRIVPVELIGTVDIRAAALTVAQIS
>Entity 2
AFDPNLVGPTLPPIPPFTL
|
|
| PDBID: | 8vbd | | Status: | HPUB -- hold until publication | | Title: | Kinetic intermediate states of HIV-1 RT DNA synthesis captured by cryo-EM | | Authors: | Vergara, S., Zhou, X., Santiago, U., Conway, J.F., Sluis-Cremer, N., Calero, G. | | Deposition date: | 2023-12-12 |
|
| PDBID: | 7gw1 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-01-09 |
|
| PDBID: | 9bdd | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM Structure of Non-Cognate Substrate Bound in the Entry Site (ES) of Human Mitochondrial Transcription Elongation Complex | | Authors: | Herbine, K.H., Nayak, A.R., Temiakov, D. | | Deposition date: | 2024-04-11 |
|
| PDBID: | 8vbe | | Status: | HPUB -- hold until publication | | Title: | Kinetic intermediate states of HIV-1 RT DNA synthesis captured by cryo-EM | | Authors: | Vergara, S., Zhou, X., Santiago, U., Conway, J.F., Sluis-Cremer, N., Calero, G. | | Deposition date: | 2023-12-12 |
|
| PDBID: | 7gw2 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-01-09 |
|
