| PDBID: | 8v5e | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-30 |
|
| PDBID: | 9b9p | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-03 | | Sequence: | >Entity 1
MTTVYYDQDVKTDALQGKKIAVVGYGSQGHAHAQNLKDNGYDVVIGIRPGRSFDKAKEDGFDVFPVAEAVKQADVIMVLLPDEIQGDVYKNEIEPNLEKHNALAFAHGFNIHFGVIQPPADVDVFLVAPKGPGHLVRRTFVEGSAVPSLFGIQQDASGQARNIALSYAKGIGATRAGVIETTFKEETETDLFGEQAVLCGGVSKLIQSGFETLVEAGYQPELAYFEVLHEMKLIVDLMYEGGMENVRYSISNTAEFGDYVSGPRVITPDVKENMKAVLTDIQNGNFSNRFIEDNKNGFKEFYKLREEQHGHQIEKVGRELREMMPFIKSKSIEKHHHHHH
|
|
| PDBID: | 8v5l | | Status: | HPUB -- hold until publication | | Title: | Structure of the Varicella Zoster Virus (VZV) gI binding domain of glycoprotein E (gE) in complex with human Fab 1A2 and 1E12 | | Authors: | Seraj, N., Holzapfel, G., Harshbarger, W. | | Deposition date: | 2023-11-30 |
|
| PDBID: | 9b9y | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-03 |
|
| PDBID: | 8v57 | | Status: | HPUB -- hold until publication | | Title: | Complex of murine cathepsin K with bound cystatin C inhibitor | | Authors: | Pedersen, L.C., Xu, D. | | Deposition date: | 2023-11-30 |
|
| PDBID: | 9b9z | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-03 |
|
| PDBID: | 8v5b | | Status: | HPUB -- hold until publication | | Title: | Structure of the oxygen-insensitive NAD(P)H-dependent nitroreductase NfsB_Ec F70A/F108Y in complex with FMN | | Authors: | Sharrock, A.V., Ackerley, D.F., Arcus, V. | | Deposition date: | 2023-11-30 |
|
| PDBID: | 9ba4 | | Status: | HOLD -- hold until a certain date | | Title: | full-length cross-linked Contactin 2 (CNTN2) | | Authors: | Liu, J.L., Fan, S.F., Ren, G.R., Rudenko, G.R. | | Deposition date: | 2024-04-03 | | Release date: | 2025-04-03 |
|
| PDBID: | 8v53 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-30 |
|
| PDBID: | 9b9q | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-03 |
|
| PDBID: | 8v50 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of a HLA-B*35:01-NP6 with D1 TCR | | Authors: | Littler, D.R., Rossjohn, J., Gras, S. | | Deposition date: | 2023-11-30 |
|
| PDBID: | 9b9x | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-03 |
|
| PDBID: | 8v51 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of a HLA-B*35:01-NP10 with D1 TCR | | Authors: | Littler, D.R., Rossjohn, J., Gras, S. | | Deposition date: | 2023-11-30 |
|
| PDBID: | 9b9t | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the ternary complex of DCAF1 and WDR5 with PROTAC, OICR-40407 | | Authors: | Mabanglo, M.F., Hoffer, L., Al-awar, R., Vedadi, M. | | Deposition date: | 2024-04-03 |
|
| PDBID: | 8v5f | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-30 |
|
| PDBID: | 9b9w | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the ternary complex of DCAF1 and WDR5 with PROTAC, OICR-40792 | | Authors: | Mabanglo, M.F., Hoffer, L., Al-awar, R., Vedadi, M. | | Deposition date: | 2024-04-03 |
|
| PDBID: | 8v58 | | Status: | HPUB -- hold until publication | | Title: | Complex of murine cathepsin K with bound heparan sulfate 12mer | | Authors: | Pedersen, L.C., Xu, D., Krahn, J.M. | | Deposition date: | 2023-11-30 |
|
| PDBID: | 9ba2 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the binary complex of DCAF1 and WDR5 | | Authors: | Mabanglo, M.F., Vedadi, M., Al-awar, R. | | Deposition date: | 2024-04-03 |
|
| PDBID: | 8v5h | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of MASTL Kinase domain in complex with an inhibitor | | Authors: | Greasley, S.E., Diehl, W. | | Deposition date: | 2023-11-30 |
|
| PDBID: | 9ba3 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-03 |
|
| PDBID: | 8v5q | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2023-11-30 |
|
| PDBID: | 9ba8 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | O-GlcNAcase (OGA) inhibitor complex for the Treatment of Alzheimer''s Disease | | Authors: | Hendle, J. | | Deposition date: | 2024-04-03 |
|
| PDBID: | 8v5p | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of the C-terminal domain of the VZV gE ectodomain in complex with the Fab of human antibody 5A2 | | Authors: | Harshbarger, W., Malito, E. | | Deposition date: | 2023-11-30 |
|
| PDBID: | 7tjr | | Status: | WAIT -- processing started, waiting for author input to continue processing | | Deposition date: | 2022-01-16 |
|
| PDBID: | 9bab | | Status: | HOLD -- hold until a certain date | | Title: | Cryo-EM of Hyper2 tube, ~27 nm diameter | | Authors: | Sonani, R.R., Miller, J.G., Conticello, V., Egelman, E.H. | | Deposition date: | 2024-04-03 | | Release date: | 2025-04-03 |
|
