| PDBID: | 8x1u | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-08 |
|
| PDBID: | 9eu4 | | Status: | HPUB -- hold until publication | | Title: | GH29A alpha-L-fucosidase | | Authors: | Yang, Y.Y., Zeuner, B., Morth, J.P. | | Deposition date: | 2024-03-27 | | Sequence: | >Entity 1
MQQKYQPTEANLKARSEFQDNKFGIFLHWGLYAMLATGEWTMTNNNLNYKEYAKLAGGFYPSKFDADKWVAAIKASGAKYICFTTRHHEGFSMFDTKYSDYNIVKATPFKRDVVKELADACAKHGIKLHFYYSHIDWYREDAPQGRTGRRTGRPNPKGDWKSYYQFMNNQLTELLTNYGPIGAIWFDGWWDQDINPDFDWELPEQYALIHRLQPACLVGNNHHQTPFAGEDIQIFERDLPGENTAGLSGQSVSHLPLETCETMNGMWGYKITDQNYKSTKTLIHYLVKAAGKDANLLMNIGPQPDGELPEVAVQRLKEVGEWMSKYGETIYGTRGGLVAPHDWGVTTQKGNKLYVHILNLQDKALFLPIVDKKVKKAVVFADKTPVRFTKNKEGIVLELAKVPTDVDYVVELTIDDEHHHHHH
|
|
| PDBID: | 8x6n | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-21 |
|
| PDBID: | 9ev2 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-28 |
|
| PDBID: | 8x0w | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-11-06 | | Release date: | 2024-11-06 |
|
| PDBID: | 9euv | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-28 |
|
| PDBID: | 8xbr | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-06 |
|
| PDBID: | 9eut | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-28 |
|
| PDBID: | 8xjr | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-22 |
|
| PDBID: | 8coc | | Status: | PROC -- to be processed | | Deposition date: | 2023-02-27 |
|
| PDBID: | 9euw | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-28 |
|
| PDBID: | 8xk1 | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of human insulin receptor bound to 4 IGF-I | | Authors: | Xi, Z. | | Deposition date: | 2023-12-22 |
|
| PDBID: | 9ev0 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-28 |
|
| PDBID: | 8xr5 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of PD-L1 complexed with small molecule inhibitor X18 | | Authors: | Liu, L. | | Deposition date: | 2024-01-06 |
|
| PDBID: | 9eux | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-28 |
|
| PDBID: | 8xqv | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of AtHPPD-YH23025 complex | | Authors: | Dong, J., Lin, H.-Y., Yang, G.-F. | | Deposition date: | 2024-01-05 |
|
| PDBID: | 9euz | | Status: | HPUB -- hold until publication | | Title: | Glycoside hydrolase family 114 enzyme from Thermotoga maritima | | Authors: | Roth, C. | | Deposition date: | 2024-03-28 |
|
| PDBID: | 8xqc | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-05 |
|
| PDBID: | 8jgn | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-05-21 | | Release date: | 2024-11-21 |
|
| PDBID: | 9euq | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-28 |
|
| PDBID: | 8wyl | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of Ryanodine receptor 1 (100 nM Ca2+, open state) | | Authors: | Qiang, C., Hongli, H. | | Deposition date: | 2023-10-31 |
|
| PDBID: | 9evc | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-28 |
|
| PDBID: | 8xqf | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-05 |
|
| PDBID: | 9eva | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-28 |
|
| PDBID: | 8xpl | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-03 |
|
