| PDBID: | 8s6y | | Status: | HPUB -- hold until publication | | Title: | Co-crystal structure of TEAD1 with OPN-9652 | | Authors: | Aplin, A.E. | | Deposition date: | 2024-02-28 |
|
| PDBID: | 8zp0 | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of YF23694-bound porcine bc1 complex | | Authors: | Wang, Y.X., Sun, J.Y., Cui, G.R., Yang, G.F. | | Deposition date: | 2024-05-29 |
|
| PDBID: | 7g65 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2023-06-05 | | Release date: | 2024-12-07 |
|
| PDBID: | 8s71 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-28 |
|
| PDBID: | 8zp6 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of Epoxide hydrolase MdEH (Mycobacterium dioxanotrophicus) | | Authors: | Zhou, Y., Lan, D.M., Wang, Y.H. | | Deposition date: | 2024-05-29 |
|
| PDBID: | 7g66 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2023-06-05 | | Release date: | 2024-12-07 |
|
| PDBID: | 8s74 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-29 |
|
| PDBID: | 8zpc | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-29 |
|
| PDBID: | 7g67 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2023-06-05 | | Release date: | 2024-12-07 |
|
| PDBID: | 8s79 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-29 |
|
| PDBID: | 8zp9 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-05-29 |
|
| PDBID: | 7g68 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2023-06-05 | | Release date: | 2024-12-07 |
|
| PDBID: | 8s75 | | Status: | HPUB -- hold until publication | | Title: | Soluble epoxide hydrolase in complex with PROTAC FL412 | | Authors: | Kumar, A., Schoenfeld, J., Hiesinger, K., Lillich, F., Proschak, E., Knapp, S., Structural Genomics Consortium (SGC) | | Deposition date: | 2024-02-29 |
|
| PDBID: | 8zpp | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-30 |
|
| PDBID: | 7g69 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2023-06-05 | | Release date: | 2024-12-07 |
|
| PDBID: | 8s7e | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-29 |
|
| PDBID: | 8zpe | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-30 |
|
| PDBID: | 7g2r | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2023-06-05 | | Release date: | 2024-12-07 |
|
| PDBID: | 8s78 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-29 |
|
| PDBID: | 7g2s | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2023-06-05 | | Release date: | 2024-12-07 |
|
| PDBID: | 8zpf | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-30 |
|
| PDBID: | 8s76 | | Status: | HPUB -- hold until publication | | Title: | Soluble epoxide hydrolase in complex with PROTAC JSF67 | | Authors: | Kumar, A., Schoenfeld, J., Hiesinger, K., Lillich, F., Proschak, E., Knapp, S., Structural Genomics Consortium (SGC) | | Deposition date: | 2024-02-29 | | Sequence: | >Entity 1
MGSSHHHHHHSSGLVPRGSHMASMLNTPAPLPTSCNPSDMSHGYVTVKPRVRLHFVELGSGPAVCLCHGFPESWYSWRYQIPALAQAGYRVLAMDMKGYGESSAPPEIEEYCMEVLCKEMVTFLDKLGLSQAVFIGHDWGGMLVWYMALFYPERVRAVASLNTPFIPANPNMSPLESIKANPVFDYQLYFQEPGVAEAELEQNLSRTFKSLFRASDESVLSMHKVCEAGGLFVNSPEEPSLSRMVTEEEIQFYVQQFKKSGFRGPLNWYRNMERNWKWACKSLGRKILIPALMVTAEKDFVLVPQMSQHMEDWIPHLKRGHIEDCGHWTQMDKPTEVNQILIKWLDSDARNPPVVSKMLLEHHHHHH
|
|
| PDBID: | 8zpg | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-30 |
|
| PDBID: | 7g2t | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2023-06-05 | | Release date: | 2024-12-07 |
|
| PDBID: | 8s7d | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of SKP1-FBXO22 in complex with a BACH1 BTB dimer at 3.2A resolution | | Authors: | Khoshouei, M., Goretzki, B. | | Deposition date: | 2024-02-29 |
|
