| PDBID: | 8wu0 | | Status: | HOLD -- hold until a certain date | | Title: | Crystal structure of lisargine | | Authors: | Wang, P., Zhu, Z. | | Deposition date: | 2023-10-19 | | Release date: | 2024-10-19 |
|
| PDBID: | 9cle | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-07-11 |
|
| PDBID: | 8wpc | | Status: | HPUB -- hold until publication | | Title: | Complex structure of AtHPPD with LB553 | | Authors: | Yang, G.-F., Lin, H.-Y., Dong, J. | | Deposition date: | 2023-10-09 |
|
| PDBID: | 9etp | | Status: | HPUB -- hold until publication | | Title: | CDK2-cyclin A in complex with FragLite 1 | | Authors: | Hope, I., Martin, M.P., Waring, M.J., Noble, M.E.M., Endicott, J.A., Tatum, N.J. | | Deposition date: | 2024-03-26 | | Sequence: | >Entity 1
GPGSMENFQKVEKIGEGTYGVVYKARNKLTGEVVALKKIRLDTETEGVPSTAIREISLLKELNHPNIVKLLDVIHTENKLYLVFEFLHQDLKKFMDASALTGIPLPLIKSYLFQLLQGLAFCHSHRVLHRDLKPQNLLINTEGAIKLADFGLARAFGVPVRTY(TPO)HEVVTLWYRAPEILLGCKYYSTAVDIWSLGCIFAEMVTRRALFPGDSEIDQLFRIFRTLGTPDEVVWPGVTSMPDYKPSFPKWARQDFSKVVPPLDEDGRSLLSQMLHYDPNKRISAKAALAHPFFQDVTKPVPHLRL
>Entity 2
GVNEVPDYHEDIHTYLREMEVKCKPKVGYMKKQPDITNSMRAILVDWLVEVGEEYKLQNETLHLAVNYIDRFLSSMSVLRGKLQLVGTAAMLLASKFEEIYPPEVAEFVYITDDTYTKKQVLRMEHLVLKVLAFDLAAPTINQFLTQYFLHQQPANCKVESLAMFLGELSLIDADPYLKYLPSVIAAAAFHLALYTVTGQSWPESLVQKTGYTLETLKPCLLDLHQTYLRAPQHAQQSIREKYKNSKYHGVSLLNPPETLNVHHHHHH
|
|
| PDBID: | 8x02 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-03 |
|
| PDBID: | 8iyz | | Status: | HOLD -- hold until a certain date | | Title: | mTurquoise2 S65T | | Authors: | Kang, J.S., Li, S.A. | | Deposition date: | 2023-04-06 | | Release date: | 2024-10-06 |
|
| PDBID: | 9etj | | Status: | HOLD -- hold until a certain date | | Title: | Mouse CNPase catalytic domain with nanobody 10E | | Authors: | Markusson, S., Raasakka, A., Opazo, F., Kursula, P. | | Deposition date: | 2024-03-26 | | Release date: | 2025-03-26 |
|
| PDBID: | 8x3v | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of 2C from encephalomyocarditis virus bound with ATP | | Authors: | Zhang, H., Zhao, H., Dong, Y.H. | | Deposition date: | 2023-11-14 |
|
| PDBID: | 9ett | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-26 |
|
| PDBID: | 8x3w | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-14 |
|
| PDBID: | 9etk | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-26 |
|
| PDBID: | 8wxl | | Status: | HPUB -- hold until publication | | Title: | Structure of the SARS-CoV-2 BA.2.86 spike glycoprotein (closed state) | | Authors: | Yajima, H., Anraku, Y., Kita, S., Kimura, K., Maenaka, K., Hashiguchi, T. | | Deposition date: | 2023-10-30 |
|
| PDBID: | 8j4o | | Status: | HOLD -- hold until a certain date | | Title: | Crystal Structure of the Acinetobacter baumannii LysR family regulator AceR effector-binding domain with Spermidine | | Authors: | Ma, J.M., Ge, H.H. | | Deposition date: | 2023-04-20 | | Release date: | 2024-10-20 |
|
| PDBID: | 9etl | | Status: | HOLD -- hold until a certain date | | Title: | Mouse CNPase catalytic domain with nanobody 8D | | Authors: | Schroder, M., Markusson, S., Raasakka, A., Opazo, F., Kursula, P. | | Deposition date: | 2024-03-26 | | Release date: | 2025-03-26 |
|
| PDBID: | 8wx8 | | Status: | HPUB -- hold until publication | | Title: | De novo design protein -T09 | | Authors: | Wang, C., Wang, S., Liu, Y. | | Deposition date: | 2023-10-27 |
|
| PDBID: | 9eto | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-26 |
|
| PDBID: | 8wxk | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of UDP-Glucose 4-Epimerase (all4713) with UDP-glucose and NAD from Nostoc sp. PCC 7120 | | Authors: | Su, J.Y. | | Deposition date: | 2023-10-30 |
|
| PDBID: | 9etr | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-26 |
|
| PDBID: | 8wz9 | | Status: | HPUB -- hold until publication | | Title: | The crystal structure of Legionella pneumophila adenosylhomocysteinase Lpg2021 in ternary complex with NAD and adenine | | Authors: | Gao, Y.S., Xie, R., Chen, Y.N., Ma, J.M., Ge, H.H. | | Deposition date: | 2023-11-01 |
|
| PDBID: | 8jf8 | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-05-17 | | Release date: | 2024-10-17 |
|
| PDBID: | 9etq | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-26 |
|
| PDBID: | 8x8e | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Cryo-EM structure of Mycobacterium tuberculosis transcription activation complex with two PhoP molecules | | Authors: | Lin, W., Shi, J. | | Deposition date: | 2023-11-27 |
|
| PDBID: | 9ets | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-26 |
|
| PDBID: | 8x8c | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2023-11-27 |
|
| PDBID: | 9eum | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-27 |
|
