PDBID: | 8za6 | Status: | HPUB -- hold until publication | Deposition date: | 2024-04-24 |
|
PDBID: | 8trz | Status: | HOLD -- hold until a certain date | Deposition date: | 2023-08-10 | Release date: | 2024-08-10 |
|
PDBID: | 8za9 | Status: | HPUB -- hold until publication | Deposition date: | 2024-04-24 |
|
PDBID: | 8trw | Status: | HPUB -- hold until publication | Deposition date: | 2023-08-10 | Release date: | 2025-02-10 |
|
PDBID: | 8zaa | Status: | HPUB -- hold until publication | Deposition date: | 2024-04-24 |
|
PDBID: | 8tru | Status: | HPUB -- hold until publication | Deposition date: | 2023-08-10 |
|
PDBID: | 8zab | Status: | HPUB -- hold until publication | Title: | Cryo-EM structure of ectodomains of HBMBPP-BTN2A1-BTN3A1 complex | Authors: | Zheng, J., Gao, W., Zhu, Y., Huang, Z. | Deposition date: | 2024-04-24 |
|
PDBID: | 8trx | Status: | HPUB -- hold until publication | Deposition date: | 2023-08-10 |
|
PDBID: | 8zay | Status: | HPUB -- hold until publication | Title: | Crystal structure of Fab | Authors: | Adachi, Y., Nogi, T. | Deposition date: | 2024-04-25 |
|
PDBID: | 8zau | Status: | HPUB -- hold until publication | Deposition date: | 2024-04-25 |
|
PDBID: | 8tsk | Status: | HPUB -- hold until publication | Deposition date: | 2023-08-11 | Release date: | 2025-02-11 |
|
PDBID: | 8zb0 | Status: | HPUB -- hold until publication | Deposition date: | 2024-04-25 |
|
PDBID: | 8tsm | Status: | HOLD -- hold until a certain date | Deposition date: | 2023-08-11 | Release date: | 2024-08-11 |
|
PDBID: | 8zac | Status: | HPUB -- hold until publication | Deposition date: | 2024-04-25 |
|
PDBID: | 8sns | Status: | POLC -- waiting for a policy decision | Deposition date: | 2023-04-27 | Release date: | 2024-06-30 |
|
PDBID: | 8zad | Status: | HPUB -- hold until publication | Deposition date: | 2024-04-25 |
|
PDBID: | 8zae | Status: | HPUB -- hold until publication | Deposition date: | 2024-04-25 |
|
PDBID: | 8tt8 | Status: | REPL -- author sent new coordinates, entry to be reprocessed | Title: | Joint Xray/Neutron structure of Macrophage Migration Inhibitory Factor (MIF) Bound to 4-hydroxyphenylpyruvate at room temperature | Authors: | Schroder, G.C., Meilleur, F., Crichlow, G.V., Lolis, E.J. | Deposition date: | 2023-08-13 |
|
PDBID: | 8zaf | Status: | HPUB -- hold until publication | Deposition date: | 2024-04-25 |
|
PDBID: | 8tt9 | Status: | HPUB -- hold until publication | Title: | X-ray structure of Macrophage Migration Inhibitory Factor (MIF) Covalently Bound to 4-hydroxyphenylpyruvate (HPP) | Authors: | Schroder, G.C., Meilleur, F., Nix, J.C., Crichlow, G.V., Lolis, E.J. | Deposition date: | 2023-08-13 | Sequence: | >Entity 1 PMFIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALCSLHSIGKIGGAQNRSYSKLLCGLLAERLRISPDRVYINYYDMNAANVGWNNSTFA
|
|
PDBID: | 8zag | Status: | HPUB -- hold until publication | Deposition date: | 2024-04-25 |
|
PDBID: | 7edq | Status: | HOLD -- hold until a certain date | Title: | MIF complex to compound7 | Authors: | Fan, C.P., Guo, D.Y., Yang, L. | Deposition date: | 2021-03-16 | Release date: | 2023-03-16 |
|
PDBID: | 8tta | Status: | HOLD -- hold until a certain date | Title: | Structure of retromer VPS29-VPS35 (483-796) complexed with Fam21A repeat 21 (1328-1341) | Authors: | Chen, K.-E., Guo, Q., Collins, B.M. | Deposition date: | 2023-08-13 | Release date: | 2024-08-13 |
|
PDBID: | 8zaj | Status: | HPUB -- hold until publication | Deposition date: | 2024-04-25 |
|
PDBID: | 8ttc | Status: | HOLD -- hold until a certain date | Title: | Structure of retromer VPS29-VPS35 (483-796) complexed with Fam21A repeat 20 (1289-1302) | Authors: | Chen, K.-E., Guo, Q., Collins, B.M. | Deposition date: | 2023-08-13 | Release date: | 2024-08-13 |
|