| PDBID: | 8tqj | | Status: | HPUB -- hold until publication | | Title: | MPI57 bound to Mpro of SARS-CoV-2 | | Authors: | Blankenship, L.R., Liu, W.R. | | Deposition date: | 2023-08-07 |
|
| PDBID: | 8z8m | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of human TNF alpha in complex with TNF30(VHH) domain of ozoralizumab | | Authors: | Mima, M., Mishima-Tsumagari, C. | | Deposition date: | 2024-04-22 |
|
| PDBID: | 8tql | | Status: | HPUB -- hold until publication | | Title: | MPI54 bound to Mpro of SARS-CoV-2 | | Authors: | Blankenship, L.R., Liu, W.R. | | Deposition date: | 2023-08-07 |
|
| PDBID: | 8z8v | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of human serum albumin in complex with ALB8(VHH) domain of ozoralizumab | | Authors: | Mima, M., Mishima-Tsumagari, C. | | Deposition date: | 2024-04-22 |
|
| PDBID: | 8tqq | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-08-08 | | Release date: | 2024-08-08 |
|
| PDBID: | 8z8w | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-22 |
|
| PDBID: | 8tqr | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-08-08 | | Release date: | 2024-08-08 |
|
| PDBID: | 8z93 | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of amyloid fibril formed by human RIPK1 RHIM protein | | Authors: | Ma, Y., Zhao, K., Liu, C. | | Deposition date: | 2024-04-22 |
|
| PDBID: | 8tqn | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-08-08 | | Release date: | 2024-08-08 |
|
| PDBID: | 8z94 | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of RIPK1 RHIM PFFs cross seeded RIPK3 RHIM amyloid fibril | | Authors: | Ma, Y., Zhao, K., Liu, C. | | Deposition date: | 2024-04-22 |
|
| PDBID: | 8tqy | | Status: | HPUB -- hold until publication | | Title: | X-Ray Crystal Structure of a dihydromethanopterin reductase (DmrA) from Methylobacterium extorquens AM1 in a H32 Spacegroup at 2.19 Angstrom Resolution | | Authors: | Axelrod, H.L., Rasche, M.E., Cascio, D., Arbig, M., Collazo, M., Potla, P.S. | | Deposition date: | 2023-08-08 | | Release date: | 2025-01-08 | | Sequence: | >Entity 1
MIDVRCICAIGQRGQLGLNGHLPWEGNTDPLFVEDVTRFFALTMGHVLIAGPKTVASVPEFAFKDRTIDVIRSHEDPEAVLKRYPGRRIFVGGGIAVWNVYAKYIQHWDVTRLPYDGEADRWFDPAWLVGGPLRHHHHHH
|
|
| PDBID: | 8z9x | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-04-23 |
|
| PDBID: | 8tqw | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2023-08-08 |
|
| PDBID: | 8z9n | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-23 |
|
| PDBID: | 8tqt | | Status: | HPUB -- hold until publication | | Title: | MPI52 bound to Mpro of SARS-CoV-2 | | Authors: | Blankenship, L.R., Liu, W.R. | | Deposition date: | 2023-08-08 |
|
| PDBID: | 8z9o | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-04-23 |
|
| PDBID: | 8tr7 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2023-08-09 |
|
| PDBID: | 8z9p | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-04-23 |
|
| PDBID: | 8tra | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-08-09 |
|
| PDBID: | 8z9g | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-23 |
|
| PDBID: | 8trb | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2023-08-09 |
|
| PDBID: | 8z9f | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-23 |
|
| PDBID: | 8trk | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-08-09 |
|
| PDBID: | 8z9m | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-04-23 |
|
| PDBID: | 8trj | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-08-09 |
|
