PDBID: | 8iz2 | Status: | HOLD -- hold until a certain date | Title: | Single excitation and two emissions pH sensor protein (SITE-pHorin)_C203E_pH8.0 | Authors: | Kang, J.S., Li, S.A. | Deposition date: | 2023-04-06 | Release date: | 2024-10-06 |
|
PDBID: | 9dcj | Status: | PROC -- to be processed | Deposition date: | 2024-08-26 |
|
PDBID: | 8yii | Status: | HPUB -- hold until publication | Deposition date: | 2024-02-29 |
|
PDBID: | 8iyv | Status: | HOLD -- hold until a certain date | Title: | Crystal structure of trypsin-famotidine complex at 2.10 Angstroms resolution | Authors: | Ahmad, M.S., Kalam, N., Akbar, Z., Rasheed, S., Choudhary, M.I. | Deposition date: | 2023-04-06 | Release date: | 2024-10-06 |
|
PDBID: | 9dck | Status: | AUTH -- processed, waiting for author review and approval | Title: | The complex structure of cGAS with BuDNA (bubble DNA) | Authors: | Wu, S., Sohn, J. | Deposition date: | 2024-08-26 |
|
PDBID: | 8yia | Status: | HPUB -- hold until publication | Deposition date: | 2024-02-29 |
|
PDBID: | 9dce | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2024-08-26 |
|
PDBID: | 8yij | Status: | HPUB -- hold until publication | Deposition date: | 2024-02-29 |
|
PDBID: | 9dcf | Status: | REPL -- author sent new coordinates, entry to be reprocessed | Deposition date: | 2024-08-26 |
|
PDBID: | 8yil | Status: | HPUB -- hold until publication | Title: | Cryo-EM structure of Saccharomyces cerevisiae bc1 complex in YF24228-bound state | Authors: | Ye, Y., Li, Z.W., Yang, G.F. | Deposition date: | 2024-02-29 |
|
PDBID: | 9dci | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2024-08-26 |
|
PDBID: | 8yin | Status: | HPUB -- hold until publication | Title: | Cryo-EM structure of Saccharomyces cerevisiae bc1 complex in YF23694-bound state | Authors: | Ye, Y., Li, Z.W., Yang, G.F. | Deposition date: | 2024-02-29 |
|
PDBID: | 8yiv | Status: | HPUB -- hold until publication | Title: | N17.1.2 recognition of NRAS neoantigens | Authors: | Wu, D.C., Mariuzza, R.A. | Deposition date: | 2024-02-29 |
|
PDBID: | 9dch | Status: | PROC -- to be processed | Title: | Single-stranded RNA-mediated PRC2 dimer | Authors: | Song, J.S., Kasinath, V.K. | Deposition date: | 2024-08-26 |
|
PDBID: | 9dcl | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2024-08-26 |
|
PDBID: | 8yj2 | Status: | HPUB -- hold until publication | Title: | N17.1.2 recognition of NRAS neoantigens | Authors: | Wu, D.C., Mariuzza, R.A. | Deposition date: | 2024-02-29 |
|
PDBID: | 9etc | Status: | HPUB -- hold until publication | Title: | Crystal structure of recombinant chicken liver Bile Acid Binding Protein (cL-BABP) in complex with chenodeoxycholic acid | Authors: | Tassone, G., Pozzi, C. | Deposition date: | 2024-03-26 | Sequence: | >Entity 1 GSHMAFSGTWQVYAQENYEEFLKALALPEDLIKMARDIKPIVEIQQKGDDFVVTSKTPRQTVTNSFTLGKEADITTMDGKKLKCTVHLANGKLVTKSEKFSHEQEVKGNEMVETITFGGVTLIRRSKRV
|
|
PDBID: | 8yj3 | Status: | HPUB -- hold until publication | Title: | N17.1.2 recognition of NRAS neoantigens | Authors: | Wu, D.C., Mariuzza, R.A. | Deposition date: | 2024-02-29 |
|
PDBID: | 9eth | Status: | HPUB -- hold until publication | Deposition date: | 2024-03-26 |
|
PDBID: | 8yje | Status: | HPUB -- hold until publication | Deposition date: | 2024-03-01 |
|
PDBID: | 9dct | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2024-08-27 |
|
PDBID: | 8yj9 | Status: | HPUB -- hold until publication | Deposition date: | 2024-03-01 |
|
PDBID: | 9dcs | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2024-08-27 |
|
PDBID: | 8yjb | Status: | HPUB -- hold until publication | Deposition date: | 2024-03-01 |
|
PDBID: | 9dcr | Status: | AUTH -- processed, waiting for author review and approval | Title: | Structure of the TelA-associated type VII secretion system chaperone SIR_0168 | Authors: | Gkragkopoulou, P., Kim, Y., Whitney, J.C. | Deposition date: | 2024-08-27 |
|