| PDBID: | 8ypz | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-18 |
|
| PDBID: | 9imk | | Status: | PROC -- to be processed | | Title: | Structural basis for concurrence of template recycling and RNA capping in SARS-CoV-2 replication/transcription | | Authors: | Yan, L.M., Rao, Z.H., Lou, Z.Y. | | Deposition date: | 2024-07-03 |
|
| PDBID: | 8rjt | | Status: | HPUB -- hold until publication | | Title: | Serial femtosecond X-ray structure of a fluorescence optimized bathy phytochrome PAiRFP2 derived from wild-type Agp2 in I6 intermediate state. | | Authors: | Sauthof, L., Schmidt, A., Szczepek, M., Brewster, A.S., Kern, J.F., Scheerer, P. | | Deposition date: | 2023-12-21 |
|
| PDBID: | 8yq0 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-18 |
|
| PDBID: | 9iml | | Status: | PROC -- to be processed | | Title: | Sertraline enhances the deubiquitinase activity of USP7 by binding to its switching loop region | | Authors: | Shi, L., Xu, Z., Chen, X., Xiong, B., Zhang, N. | | Deposition date: | 2024-07-03 |
|
| PDBID: | 8rk0 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-22 |
|
| PDBID: | 8yq1 | | Status: | HPUB -- hold until publication | | Title: | Linear form of FGF10 from Homo sapiens | | Authors: | Park, H.J., Park, Y.S., Lee, C.E., Kang, L.W. | | Deposition date: | 2024-03-18 |
|
| PDBID: | 9imm | | Status: | PROC -- to be processed | | Title: | Structural basis for concurrence of template recycling and RNA capping in SARS-CoV-2 replication/transcription | | Authors: | Yan, L.M., Rao, Z.H., Lou, Z.Y. | | Deposition date: | 2024-07-03 |
|
| PDBID: | 8rka | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-23 |
|
| PDBID: | 8yqi | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-19 |
|
| PDBID: | 9fz2 | | Status: | PROC -- to be processed | | Deposition date: | 2024-07-04 |
|
| PDBID: | 8rk9 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-23 |
|
| PDBID: | 8yq8 | | Status: | HPUB -- hold until publication | | Title: | Quadruple mutant (N51I+C59R+S108N+I164L) Plasmodium falciparum dihydrofolate reductase-thymidylate synthase (PfDHFR-TS V1/S) complexed with FB8, NADPH and dUMP | | Authors: | Vanichtanankul, J., Vitsupakorn, D., Saeyang, T., Arwon, U., Hoarau, M., Decharuangsilp, S., Kamchonwongpaisan, S., Yuthavong, Y. | | Deposition date: | 2024-03-19 | | Sequence: | >Entity 1
MMEQVCDVFDIYAICACCKVESKNEGKKNEVFNNYTFRGLGNKGVLPWKCISLDMKYFRAVTTYVNESKYEKLKYKRCKYLNKETVDNVNDMPNSKKLQNVVVMGRTNWESIPKKFKPLSNRINVILSRTLKKEDFDEDVYIINKVEDLIVLLGKLNYYKCFILGGSVVYQEFLEKKLIKKIYFTRINSTYECDVFFPEINENEYQIISVSDVYTSNNTTLDFIIYKKTNNKMLNEQNCIKGEEKNNDMPLKNDDKDTCHMKKLTEFYKNVDKYKINYENDDDDEEEDDFVYFNFNKEKEEKNKNSIHPNDFQIYNSLKYKYHPEYQYLNIIYDIMMNGNKQSDRTGVGVLSKFGYIMKFDLSQYFPLLTTKKLFLRGIIEELLWFIRGETNGNTLLNKNVRIWEANGTREFLDNRKLFHREVNDLGPIYGFQWRHFGAEYTNMYDNYENKGVDQLKNIINLIKNDPTSRRILLCAWNVKDLDQMALPPCHILCQFYVFDGKLSCIMYQRSCDLGLGVPFNIASYSIFTHMIAQVCNLQPAQFIHVLGNAHVYNNHIDSLKIQLNRIPYPFPTLKLNPDIKNIEDFTISDFTIQNYVHHEKISMDMAA
|
|
| PDBID: | 9fn6 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Full-length crystal structure of human Fascin 1 | | Authors: | Quereda-Moraleda, I., Grieco, A., Martin-Garcia, J.M. | | Deposition date: | 2024-06-09 |
|
| PDBID: | 8rk8 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-23 |
|
| PDBID: | 8yq9 | | Status: | HPUB -- hold until publication | | Title: | Quadruple mutant (N51I+C59R+S108N+I164L) Plasmodium falciparum dihydrofolate reductase-thymidylate synthase (PfDHFR-TS V1/S) complexed with FB6, NADPH and dUMP | | Authors: | Vanichtanankul, J., Vitsupakorn, D., Saeyang, T., Arwon, U., Hoarau, M., Decharuangsilp, S., Kamchonwongpaisan, S., Yuthavong, Y. | | Deposition date: | 2024-03-19 | | Sequence: | >Entity 1
MMEQVCDVFDIYAICACCKVESKNEGKKNEVFNNYTFRGLGNKGVLPWKCISLDMKYFRAVTTYVNESKYEKLKYKRCKYLNKETVDNVNDMPNSKKLQNVVVMGRTNWESIPKKFKPLSNRINVILSRTLKKEDFDEDVYIINKVEDLIVLLGKLNYYKCFILGGSVVYQEFLEKKLIKKIYFTRINSTYECDVFFPEINENEYQIISVSDVYTSNNTTLDFIIYKKTNNKMLNEQNCIKGEEKNNDMPLKNDDKDTCHMKKLTEFYKNVDKYKINYENDDDDEEEDDFVYFNFNKEKEEKNKNSIHPNDFQIYNSLKYKYHPEYQYLNIIYDIMMNGNKQSDRTGVGVLSKFGYIMKFDLSQYFPLLTTKKLFLRGIIEELLWFIRGETNGNTLLNKNVRIWEANGTREFLDNRKLFHREVNDLGPIYGFQWRHFGAEYTNMYDNYENKGVDQLKNIINLIKNDPTSRRILLCAWNVKDLDQMALPPCHILCQFYVFDGKLSCIMYQRSCDLGLGVPFNIASYSIFTHMIAQVCNLQPAQFIHVLGNAHVYNNHIDSLKIQLNRIPYPFPTLKLNPDIKNIEDFTISDFTIQNYVHHEKISMDMAA
|
|
| PDBID: | 9fn5 | | Status: | HOLD -- hold until a certain date | | Title: | The REC domain (in the non-phosphorylated state) of XynC, a response regulator from G.proteiniphilus T-6 | | Authors: | Hadad, N., Lavid, N., Pazy, Y., Hiya, D., Shoham, Y., Shoham, G. | | Deposition date: | 2024-06-09 | | Release date: | 2025-06-09 |
|
| PDBID: | 8rk7 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-23 |
|
| PDBID: | 8yqn | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2024-03-19 | | Release date: | 2025-03-19 |
|
| PDBID: | 9fn7 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-06-09 |
|
| PDBID: | 8rk6 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-23 |
|
| PDBID: | 8yq6 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-19 |
|
| PDBID: | 9fn8 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-06-09 |
|
| PDBID: | 8rkc | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-23 |
|
| PDBID: | 9fz3 | | Status: | PROC -- to be processed | | Title: | Crystal structure of K38 amylase from Bacillus sp. strain KSM-K38 covalently bound to alpha-1,6 branched pseudo-trisaccharide activity-based probe | | Authors: | Pickles, I.B., Moroz, O., Davies, G. | | Deposition date: | 2024-07-04 |
|
