| PDBID: | 8yag | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-09 |
|
| PDBID: | 9im6 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-07-02 |
|
| PDBID: | 8r1u | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-02 |
|
| PDBID: | 8yod | | Status: | HPUB -- hold until publication | | Title: | structure of phage T6 apo full-length topoisomerase II | | Authors: | Chen, Y.T., Xin, Y.H., Xian, R.Q. | | Deposition date: | 2024-03-13 |
|
| PDBID: | 9ima | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-07-02 |
|
| PDBID: | 8rhv | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of Trypanosoma brucei PTR1 in complex with the cofactor and inhibitor P30 | | Authors: | Pozzi, C., Mangani, S., Landi, G. | | Deposition date: | 2023-12-17 | | Sequence: | >Entity 1
MGSSHHHHHHSSGLVPRGSHMMEAPAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAAVSLADELNKERSNTAVVCQADLTNSNVLPASCEEIINSCFRAFGRCDVLVNNASAFYPTPLVQGDHEDNSNGKTVETQVAELIGTNAIAPFLLTMSFAQRQKGTNPNCTSSNLSIVNLCDAMVDQPCMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAMGEEEKDKWRRKVPLGRREASAEQIADAVIFLVSGSAQYITGSIIKVDGGLSLVHA
|
|
| PDBID: | 8yon | | Status: | HPUB -- hold until publication | | Title: | structure of phage T6 full-length topoisomerase II bound with DNA | | Authors: | Chen, Y.T., Xin, Y.H., Xian, R.Q. | | Deposition date: | 2024-03-13 |
|
| PDBID: | 9im9 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | CTB10-M4-ent-1d complex | | Authors: | Fu, K., Rao, Y.J. | | Deposition date: | 2024-07-02 |
|
| PDBID: | 8rhu | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of Trypanosoma brucei PTR1 in complex with the cofactor and inhibitor P25 | | Authors: | Pozzi, C., Mangani, S., Landi, G. | | Deposition date: | 2023-12-17 | | Sequence: | >Entity 1
MGSSHHHHHHSSGLVPRGSHMMEAPAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAAVSLADELNKERSNTAVVCQADLTNSNVLPASCEEIINSCFRAFGRCDVLVNNASAFYPTPLVQGDHEDNSNGKTVETQVAELIGTNAIAPFLLTMSFAQRQKGTNPNCTSSNLSIVNLCDAMVDQP(CSX)MAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAMGEEEKDKWRRKVPLGRREASAEQIADAVIFLVSGSAQYITGSIIKVDGGLSLVHA
|
|
| PDBID: | 8yos | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Nanobody in complex with LILRB3 | | Authors: | Jin, C., Shi, Y. | | Deposition date: | 2024-03-13 |
|
| PDBID: | 9imb | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | The crystal structure of human m5C methyltransferase NSUN6 bound to its S-adenosyl-L-methionine analog and a NECTIN-2 3''-UTR RNA substrate | | Authors: | Lv, M.Q., Zhong, F.M., Pu, T. | | Deposition date: | 2024-07-02 |
|
| PDBID: | 8rhw | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of Trypanosoma brucei PTR1 in complex with the cofactor and inhibitor P31 | | Authors: | Pozzi, C., Mangani, S., Landi, G. | | Deposition date: | 2023-12-17 | | Sequence: | >Entity 1
MGSSHHHHHHSSGLVPRGSHMMEAPAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAAVSLADELNKERSNTAVVCQADLTNSNVLPASCEEIINSCFRAFGRCDVLVNNASAFYPTPLVQGDHEDNSNGKTVETQVAELIGTNAIAPFLLTMSFAQRQKGTNPNCTSSNLSIVNLCDAMVDQPCMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAMGEEEKDKWRRKVPLGRREASAEQIADAVIFLVSGSAQYITGSIIKVDGGLSLVHA
|
|
| PDBID: | 8yoa | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-13 |
|
| PDBID: | 9im8 | | Status: | PROC -- to be processed | | Deposition date: | 2024-07-02 |
|
| PDBID: | 8rhx | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of Trypanosoma brucei PTR1 in complex with the cofactor and inhibitor P32 | | Authors: | Pozzi, C., Mangani, S., Landi, G. | | Deposition date: | 2023-12-17 | | Sequence: | >Entity 1
MGSSHHHHHHSSGLVPRGSHMMEAPAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAAVSLADELNKERSNTAVVCQADLTNSNVLPASCEEIINSCFRAFGRCDVLVNNASAFYPTPLVQGDHEDNSNGKTVETQVAELIGTNAIAPFLLTMSFAQRQKGTNPNCTSSNLSIVNLCDAMVDQPCMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAMGEEEKDKWRRKVPLGRREASAEQIADAVIFLVSGSAQYITGSIIKVDGGLSLVHA
|
|
| PDBID: | 8yoq | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of hFSP1 with both 6-OH-FAD and NADP (hFSP1-6-OH-FAD-NADP) | | Authors: | Lan, H.Y., Gao, Y., Hong, T., Zhao, Z.Z., Chang, Z.H., Wang, Y.F., Wang, F. | | Deposition date: | 2024-03-13 |
|
| PDBID: | 9im5 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Tubulin-RB3(MUT)-TTL-Y12 | | Authors: | Yang, J.H. | | Deposition date: | 2024-07-02 | | Release date: | 2025-07-02 |
|
| PDBID: | 8rig | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-18 |
|
| PDBID: | 8yor | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-13 |
|
| PDBID: | 9im7 | | Status: | PROC -- to be processed | | Title: | Crystal structure of mouse Plk1-PBD in complex with R12-4j compound | | Authors: | Kim, E.E., Shin, S.C. | | Deposition date: | 2024-07-02 | | Release date: | 2025-07-02 |
|
| PDBID: | 8rif | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-18 |
|
| PDBID: | 8yot | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Nanobody in complex with LILRB3 | | Authors: | Jin, C., Shi, Y. | | Deposition date: | 2024-03-13 |
|
| PDBID: | 9fyf | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of human Casein Kinase II subunit alpha (CK2a1) in complex with TR06772818 | | Authors: | Kraemer, A., Ong, H.W., Yang, X., Brown, J.W., Chang, E., Willson, T., Knapp, S., Structural Genomics Consortium (SGC) | | Deposition date: | 2024-07-03 |
|
| PDBID: | 8ri6 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-18 |
|
| PDBID: | 9fym | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Lacto-N-biosidase from Treponema denticola ATCC 35405 | | Authors: | Vuillemin, M., Siebenhaar, S., Zeuner, B., Morth, J.P. | | Deposition date: | 2024-07-03 |
|
