| PDBID: | 9ftb | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-06-24 |
|
| PDBID: | 8r0y | | Status: | HPUB -- hold until publication | | Title: | Pim1 in complex with 3-((3-hydroxyphenyl)amino)quinoxaline-2-carboxylic acid and Pimtide | | Authors: | Hochban, P.M.M., Heine, A., Diederich, W.E. | | Deposition date: | 2023-11-01 | | Sequence: | >Entity 1
SMLLSKINSLAHLRAAPCNDLHATKLAPGKEKEPLESQYQVGPLLGSGGFGSVYSGIRVSDNLPVAIKHVEKDRISDWGELPNGTRVPMEVVLLKKVSSGFSGVIRLLDWFERPDSFVLILERPEPVQDLFDFITERGALQEELARSFFWQVLEAVRHCHNCGVLHRDIKDENILIDLNRGELKLIDFGSGALLKDTVYTDFDGTRVYSPPEWIRYHRYHGRSAAVWSLGILLYDMVCGDIPFEHDEEIIGGQVFFRQRVS(SEP)ECQHLIRWCLALRPSDRPTFEEIQNHPWMQDVLLPQETAEIHLHSLSPGPS
>Entity 2
ARKRRRHPSGPPTA
|
|
| PDBID: | 8yex | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-23 |
|
| PDBID: | 9ftd | | Status: | HPUB -- hold until publication | | Title: | NMR Structure of BmSA1, the surface antigen of Babesia microti | | Authors: | Barthe, P., Roumestand, C., Mouhand, A., Delbecq, S. | | Deposition date: | 2024-06-24 |
|
| PDBID: | 8r13 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Alpha-1-antitrypsin (Met374Phe) in the native conformation | | Authors: | Aldobiyan, I., Lomas, D.A., Irving, J.A. | | Deposition date: | 2023-11-01 |
|
| PDBID: | 8yez | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Human PIEZO1 | | Authors: | Zhang, M.F. | | Deposition date: | 2024-02-23 | | Release date: | 2025-02-23 |
|
| PDBID: | 9ft9 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-06-24 |
|
| PDBID: | 8r23 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-02 |
|
| PDBID: | 8yer | | Status: | HPUB -- hold until publication | | Title: | Tubulin-RB3_SLD-TTL in complex with compound 4 | | Authors: | Wu, C.Y., Wang, Y.X. | | Deposition date: | 2024-02-23 |
|
| PDBID: | 9fth | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Open conformation of the pentameric ligand-gated ion channel, DeCLIC at pH 5 with 10mM Ca2+ | | Authors: | Rovsnik, U., Anden, O., Lycksell, M., Delarue, M., Howard, R.J., Lindahl, E. | | Deposition date: | 2024-06-24 |
|
| PDBID: | 8r22 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-02 |
|
| PDBID: | 8yeu | | Status: | HPUB -- hold until publication | | Title: | Tubulin-RB3_SLD-TTL in complex with compound 2NH2 | | Authors: | Wu, C.Y., Wang, Y.X. | | Deposition date: | 2024-02-23 |
|
| PDBID: | 9ftj | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Closed and disordered conformation of the pentameric ligand-gated ion channel, DeCLIC at pH 5 with 10mM EDTA | | Authors: | Rovsnik, U., Anden, O., Lycksell, M., Delarue, M., Howard, R.J., Lindahl, E. | | Deposition date: | 2024-06-24 |
|
| PDBID: | 8qvp | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-11-02 | | Release date: | 2024-11-02 |
|
| PDBID: | 8yf3 | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2024-02-23 | | Release date: | 2025-02-23 |
|
| PDBID: | 9fta | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of d(GGGGTTTTGGGG) with Zn and K | | Authors: | Sbirkova-Dimitrova, H.I., Shivachev, B.L. | | Deposition date: | 2024-06-24 | | Release date: | 2024-12-24 |
|
| PDBID: | 8r1o | | Status: | HPUB -- hold until publication | | Title: | nuclease complex from C. thermophilum | | Authors: | Lazzaretti, D., Liebau, J., Pilsl, M., Sprangers, R. | | Deposition date: | 2023-11-02 |
|
| PDBID: | 8yfk | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of FIP200 claw/TNIP1_FIR_pS123 | | Authors: | Lv, M.Q., Wu, S.M. | | Deposition date: | 2024-02-24 |
|
| PDBID: | 9ijm | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Bacterial flagellar sodium-driven stator PomA5PomB2 with 100 mM NaCl and 0.1 mM phenamil | | Authors: | Nishikino, T., Takekawa, N., Imada, K. | | Deposition date: | 2024-06-24 |
|
| PDBID: | 8r1m | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-02 | | Sequence: | >Entity 1
AMALTGCSEKININEDKISHKIDIPDSAWTIGIGEKFKNAGHPNVKYPMIDDSYVQGAPLGGFGAGTIGRTYNGGFSRWHLEIGKNKYTTVYANQFSVFQKVEGNKDGVAQVLYAGEPENGYLSSWKWDYPKESGMYYALYPNSWYTYTNKDLPVQLAVKQFSPIIPYNYKETSYPVAVFKWTAYNPTNKNVDVSIMFTWQNMIGFFGKQVNVNSGNFNKIIKDKSKDSEIVAAVMGNISNDNEEWNGEYSIGVKKVPGVDISYKAKFVTTGDGSDLWHEFSKNGILDNKDDETPTKQDGIGSAIAVNFKLQPGQTIEVPFALSWDLPIMKFGGGDKWYKMYTKYFGKNGKNSFAILKEALNNYQKWEKMIDDWQKPILSNKSKPDWYKTALFNELYYLADGGTAWENGKVGEKDKRTNNMFGLLECFDYNYYETLDVRFYGSFPLVMLWPDIEKQVMRQFADTINVQDSSEFKVGSNGAMAVKKVQGMIPHDLGSSYALPWIKINAYDWQNPNIWKDLNSKYVLLVYRDYVLTGKTDKEFLKYTWKSVKTALDKLKEMDKDNDGIPDNEGIPDQTYDTWSMKGTSAYCGSLWLAALKAAQEIGKVLKDNEAYIKYNEWYKIAQQNFEKELWNGEYYNFDTESDHKDSIMADQLAGQWYADILRLGDILPKDHVQKALKKIYEFNVMKFENGKMGAVNGMRPDGIVDESDIQAQEVWTGVTYALASFMKYRGMTEEAYNTAYGVYKMTYDKSGKGYWFRTPEAWTKDGNYRASMYMRPLSIWSMEVNYNEVLEHHHHHH
|
|
| PDBID: | 8yfl | | Status: | HPUB -- hold until publication | | Title: | crystal structure of FIP200 claw/TNIP1_FIR_pS122pS123 | | Authors: | Lv, M.Q., Wu, S.M. | | Deposition date: | 2024-02-24 |
|
| PDBID: | 9ijk | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | The CryoEM structure of a C-C bond hydrolase MhpC homotetramer | | Authors: | Jiang, W.X., Cheng, X.Q., Ma, L.X., Xing, Q. | | Deposition date: | 2024-06-24 |
|
| PDBID: | 8r1z | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-02 |
|
| PDBID: | 8yfa | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Human PIEZO1-MDFIC | | Authors: | Zhang, M.F. | | Deposition date: | 2024-02-24 | | Release date: | 2025-02-24 |
|
| PDBID: | 9ftn | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal Structure of Autotaxin (ENPP2) with Type VI Inhibitor, a Novel Class of Inhibitors with Three-Point Lock Binding Mode | | Authors: | Borza, R., Joosten, R.P., Perrakis, A. | | Deposition date: | 2024-06-25 |
|
