| PDBID: | 8qj5 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the Levansucrase beta from Pseudomonas syringae pv. actinidiae | | Authors: | Ferraroni, M., Peritore, L. | | Deposition date: | 2023-09-12 |
|
| PDBID: | 8y5i | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of E.Coli ABC transporter with ATP | | Authors: | Qiao, Z., Gao, Y.G. | | Deposition date: | 2024-01-31 |
|
| PDBID: | 9fod | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Glyceraldehyde 3-phosphate dehydrogenase A (GAPDHA) apoenzyme, from Helicobacter pylori | | Authors: | Foster, S.P., Moody, P.C.E. | | Deposition date: | 2024-06-11 |
|
| PDBID: | 8y5u | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-01 |
|
| PDBID: | 8qiy | | Status: | HPUB -- hold until publication | | Title: | Structure of Mycobacterium abscessus Phosphopantetheine adenylyltransferase in complex with inhibitor | | Authors: | Thomas, S.E., McCarthy, W.J., Coyne, A.G., Blundell, T.L. | | Deposition date: | 2023-09-12 |
|
| PDBID: | 9foc | | Status: | PROC -- to be processed | | Title: | Crystal structure of the PWWP1 domain of NSD2 bound by compound 11. | | Authors: | Collie, G.W. | | Deposition date: | 2024-06-11 |
|
| PDBID: | 8qix | | Status: | HPUB -- hold until publication | | Title: | Structure of Mycobacterium abscessus Phosphopantetheine adenylyltransferase in complex with inhibitor | | Authors: | Thomas, S.E., McCarthy, W.J., Coyne, A.G., Blundell, T.L. | | Deposition date: | 2023-09-12 |
|
| PDBID: | 8y5w | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-01 |
|
| PDBID: | 9foe | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of the PWWP1 domain of NSD2 bound by compound 7. | | Authors: | Collie, G.W. | | Deposition date: | 2024-06-11 |
|
| PDBID: | 8y5x | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-01 |
|
| PDBID: | 8qj6 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of cytochrome domain 1 from PgcA | | Authors: | Nash, B.W., Edwards, M.J., Clarke, T.A. | | Deposition date: | 2023-09-12 |
|
| PDBID: | 9fof | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-06-11 |
|
| PDBID: | 8qjb | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-13 |
|
| PDBID: | 8y5y | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-01 |
|
| PDBID: | 9fom | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | CRYSTAL STRUCTURE OF AS-ISOLATED F295L MUTANT OF THREE-DOMAIN HEME-CU NITRITE REDUCTASE FROM RALSTONIA PICKETTII | | Authors: | Petchyam, N., Antonyuk, S.V., Hasnain, S.S. | | Deposition date: | 2024-06-12 |
|
| PDBID: | 8y5z | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-01 |
|
| PDBID: | 8qjk | | Status: | HPUB -- hold until publication | | Title: | Structure of the cytoplasmic domain of csx23 from Vibrio cholera in complex with cyclic tetra-adenylate (cA4) | | Authors: | McMahon, S.A., McQuarrie, S., Gloster, T.M., Gruschow, S., White, M.F. | | Deposition date: | 2023-09-13 | | Sequence: | >Entity 1
GANAMDEITVVLKSPNGKNIKCPPMPRKDFSRAEVLGYIGMCSGAQRFEIASLKTPKFGENLLKIIKSKGSQSFIVDCTDEEIDQFSAETKSGSNA
>Entity 2
AAAA
|
|
| PDBID: | 9fp1 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Biochemical and Structural Characterization of ADAR1 Deaminase Domain | | Authors: | Graedler, U., Freire, F. | | Deposition date: | 2024-06-12 |
|
| PDBID: | 8qjl | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-13 |
|
| PDBID: | 8y61 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-01 |
|
| PDBID: | 9fos | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | The structure of ornithine decarboxylase from Leishmania infantum in complex with PLP and DFMO | | Authors: | Fiorillo, A., Ilari, A. | | Deposition date: | 2024-06-12 |
|
| PDBID: | 8qjm | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-13 |
|
| PDBID: | 8y64 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of open state ferulic acid decarboxylase from Saccharomyces cerevisiae, F397V/I398L/T438P/P441V mutant | | Authors: | Feng, Y.B., Song, X., Zhu, X.N. | | Deposition date: | 2024-02-01 |
|
| PDBID: | 9fou | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Acetophenone carboxylase subunit epsilon ApcE | | Authors: | Ermler, U., Heider, H., Demmer, U. | | Deposition date: | 2024-06-12 |
|
| PDBID: | 8qjn | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-13 |
|
