| PDBID: | 8qgm | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of NAD kinase 1 from Listeria monocytogenes in complex with a di-adenosine derivative | | Authors: | Gelin, M., Labesse, G., Lionne, C. | | Deposition date: | 2023-09-05 |
|
| PDBID: | 8y00 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-21 |
|
| PDBID: | 9ci2 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Anthoceros agrestis Rubisco assembled with Raf1 Raf2 and BSD2 | | Authors: | Ang, W.S.L., Oh, Z.G., Li, F.W., Gunn, L.H. | | Deposition date: | 2024-07-02 |
|
| PDBID: | 8qgn | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of NAD kinase 1 from Listeria monocytogenes in complex with a di-adenosine derivative | | Authors: | Gelin, M., Labesse, G., Lionne, C. | | Deposition date: | 2023-09-05 |
|
| PDBID: | 8xzw | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-21 |
|
| PDBID: | 9ci5 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-07-02 |
|
| PDBID: | 8qgo | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of NAD kinase 1 from Listeria monocytogenes in complex with a di-adenosine derivative | | Authors: | Gelin, M., Labesse, G., Lionne, C. | | Deposition date: | 2023-09-05 |
|
| PDBID: | 8xzk | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-21 |
|
| PDBID: | 9ci6 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-07-02 |
|
| PDBID: | 8qgp | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-05 | | Release date: | 2025-03-11 |
|
| PDBID: | 8xzl | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-21 |
|
| PDBID: | 9ci8 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-07-02 |
|
| PDBID: | 8qgq | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-05 | | Release date: | 2025-03-09 |
|
| PDBID: | 8xzn | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-21 |
|
| PDBID: | 9ci9 | | Status: | PROC -- to be processed | | Deposition date: | 2024-07-02 |
|
| PDBID: | 8qgv | | Status: | HPUB -- hold until publication | | Title: | Human Carbonic Anhydrase I in complex with 4-(5-acetyl-6-methyl-2-oxo-1,2,3,4-tetrahydropyrimidin-4-yl)benzenesulfonamide | | Authors: | Angeli, A., Ferraroni, M. | | Deposition date: | 2023-09-05 | | Sequence: | >Entity 1
MASPDWGYDDKNGPEQWSKLYPIANGNNQSPVDIKTSETKHDTSLKPISVSYNPATAKEIINVGHSFHVNFEDNDNRSVLKGGPFSDSYRLFQFHFHWGSTNEHGSEHTVDGVKYSAELHVAHWNSAKYSSLAEAASKADGLAVIGVLMKVGEANPKLQKVLDALQAIKTKGKRAPFTNFDPSTLLPSSLDFWTYPGSLTHPPLYESVTWIICKESISVSSEQLAQFRSLLSNVEGDNAVPMQHNNRPTQPLKGRTVRASF
|
|
| PDBID: | 8xzx | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-21 |
|
| PDBID: | 9cip | | Status: | PROC -- to be processed | | Deposition date: | 2024-07-03 |
|
| PDBID: | 8qh5 | | Status: | HPUB -- hold until publication | | Title: | CryoEM structure of UVSSA(VHS)-CSA-DDB1-DDA1 | | Authors: | Lee, S.-H., Sixma, T.K. | | Deposition date: | 2023-09-06 |
|
| PDBID: | 8xzo | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-21 |
|
| PDBID: | 9cig | | Status: | PROC -- to be processed | | Deposition date: | 2024-07-03 |
|
| PDBID: | 8qgx | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-06 |
|
| PDBID: | 8xzp | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-21 |
|
| PDBID: | 9cif | | Status: | PROC -- to be processed | | Deposition date: | 2024-07-03 |
|
| PDBID: | 8qgz | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-06 |
|
