| PDBID: | 8wrq | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of Cas12-1 with 14 nt complementary heteroduplex | | Authors: | Zhang, K., Zhang, X. | | Deposition date: | 2023-10-16 |
|
| PDBID: | 8ws8 | | Status: | HOLD -- hold until a certain date | | Title: | Cryo-EM mini structure of Cas12-1/crRNA/Target DNA complex | | Authors: | Kuo, Z., Xi, Z. | | Deposition date: | 2023-10-16 | | Release date: | 2024-10-16 |
|
| PDBID: | 8wrv | | Status: | HOLD -- hold until a certain date | | Title: | Cryo-EM mini structure of Cas12-2/crRNA/Target DNA complex | | Authors: | Kuo, Z., Xi, Z. | | Deposition date: | 2023-10-16 | | Release date: | 2024-10-16 |
|
| PDBID: | 8wru | | Status: | HOLD -- hold until a certain date | | Title: | Cryo-EM structure of Cas12-2/crRNA/Target DNA complex | | Authors: | Kuo, Z., Xi, Z. | | Deposition date: | 2023-10-16 | | Release date: | 2024-10-16 |
|
| PDBID: | 8ws7 | | Status: | HOLD -- hold until a certain date | | Title: | Cryo-EM mini structure of Cas12-1 with 10 nt complementary heteroduplex | | Authors: | Kuo, Z., Xi, Z. | | Deposition date: | 2023-10-16 | | Release date: | 2024-10-16 |
|
| PDBID: | 8wrt | | Status: | HOLD -- hold until a certain date | | Title: | Cryo-EM structure of Cas12-1/crRNA complex | | Authors: | Kuo, Z., Xi, Z. | | Deposition date: | 2023-10-16 | | Release date: | 2024-10-16 |
|
| PDBID: | 8ws6 | | Status: | HOLD -- hold until a certain date | | Title: | Cryo-EM mini structure of Cas12-1 with 14 nt complementary heteroduplex | | Authors: | Kuo, Z., Xi, Z. | | Deposition date: | 2023-10-16 | | Release date: | 2024-10-16 |
|
| PDBID: | 8ws5 | | Status: | HOLD -- hold until a certain date | | Title: | Cryo-EM structure of Cas12-1-N2/crRNA/Target DNA complex | | Authors: | Kuo, Z., Xi, Z. | | Deposition date: | 2023-10-16 | | Release date: | 2024-10-16 |
|
| PDBID: | 8wrw | | Status: | HOLD -- hold until a certain date | | Title: | Cryo-EM mini structure of Cas12-1-N1/crRNA/Target DNA complex | | Authors: | Kuo, Z., Xi, Z. | | Deposition date: | 2023-10-16 | | Release date: | 2024-10-16 |
|
| PDBID: | 8wrp | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of Cas12-1 with 20 nt complementary heteroduplex | | Authors: | Kuo, Z., Xi, Z. | | Deposition date: | 2023-10-16 |
|
| PDBID: | 8ws4 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-16 |
|
| PDBID: | 8wry | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-16 |
|
| PDBID: | 8wri | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of FrCas9 in complex with sgRNA and 26-nt TS and 4-nt NTS substrates | | Authors: | Chen, S.D., Yang, M., Liu, S.Q. | | Deposition date: | 2023-10-15 |
|
| PDBID: | 8wrn | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-10-15 | | Release date: | 2024-10-15 |
|
| PDBID: | 8uko | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2023-10-14 |
|
| PDBID: | 8ukn | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-14 |
|
| PDBID: | 8ukp | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2023-10-14 |
|
| PDBID: | 8wrg | | Status: | HPUB -- hold until publication | | Title: | Solution structure of the TAD domain (450-504) of human transcriptional coactivator YAP1 | | Authors: | Zhang, H., Li, Y. | | Deposition date: | 2023-10-14 |
|
| PDBID: | 8wrf | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of MexL | | Authors: | Wei, Y., Wu, Z.K. | | Deposition date: | 2023-10-14 | | Sequence: | >Entity 1
GSHMDPAKREAILEAAKRLFLCNGYDGSSMEAIASEAGVSKLTVYSHFTDKETLFSEAVKAKCAEQLPALYFQLAEGAPLEKVLLNIARGFHRLINSHEAIALTRLMAAQAGQNPKLSELFFEAGPKQVIDEMERLLEQARRSGKLAFPDARHAAEHFFMLVKGCANYRLLIGCAEPLDEAEGERHVEEVVALFLRAFAAGG
|
|
| PDBID: | 8qtw | | Status: | HPUB -- hold until publication | | Title: | Structure of human butyrylcholinesterase with (3-(((2-cycloheptylethyl)(methyl)amino)methyl)-1H-indol-7-yl)(methyl)carbamoylated Ser198 | | Authors: | Brazzolotto, X., Meden, A., Knez, D., Gobec, S., Nachon, F. | | Deposition date: | 2023-10-13 |
|
| PDBID: | 8qtx | | Status: | HPUB -- hold until publication | | Title: | Structure of human butyrylcholinesterase with 3-(((2-cycloheptylethyl)(methyl)amino)methyl)-N-methyl-1H-indol-7-amine | | Authors: | Brazzolotto, X., Meden, A., Knez, D., Gobec, S., Nachon, F. | | Deposition date: | 2023-10-13 |
|
| PDBID: | 8qtu | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of human Sirt2 in complex with the super-slow substrate TNFn-3 and NAD+ | | Authors: | Friedrich, F., Kalbas, D., Meleshin, M., Einsle, O., Schutkowski, M., Jung, M. | | Deposition date: | 2023-10-13 |
|
| PDBID: | 8qtz | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM reconstruction of VP5*/VP8* assembly from SA11 Rotavirus Tripsinized Triple Layered Particle | | Authors: | Asensio-Cob, D., Perez-Mata, C., Gomez-Blanco, J., Vargas, J., Rodriguez, J.M., Luque, D. | | Deposition date: | 2023-10-13 |
|
| PDBID: | 8qu0 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-13 | | Release date: | 2025-04-16 |
|
| PDBID: | 8qu6 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-13 |
|
