| PDBID: | 9cd8 | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of Acetyl-CoA synthetase from Cryptococcus neoformans H99 in complex with inhibitor HGN-1310 (dd3-027) | | Authors: | Seattle Structural Genomics Center for Infectious Disease, Seattle Structural Genomics Center for Infectious Disease (SSGCID) | | Deposition date: | 2024-06-24 |
|
| PDBID: | 8vx4 | | Status: | HPUB -- hold until publication | | Title: | Human OGG1 bound to a 35-bp DNA with an 8-oxoG in the middle | | Authors: | You, Q., Li, H. | | Deposition date: | 2024-02-03 |
|
| PDBID: | 8vx5 | | Status: | HPUB -- hold until publication | | Title: | Nucleosome core particle containing an 8-oxoG damage site | | Authors: | You, Q., Li, H. | | Deposition date: | 2024-02-03 |
|
| PDBID: | 9cdq | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-06-25 |
|
| PDBID: | 8vx6 | | Status: | HPUB -- hold until publication | | Title: | Human OGG1 bound at the nucleosomal DNA entry site | | Authors: | You, Q., Li, H. | | Deposition date: | 2024-02-03 |
|
| PDBID: | 9cdr | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-06-25 |
|
| PDBID: | 8vx7 | | Status: | HPUB -- hold until publication | | Title: | Computationally designed tunable C2 symmetric tandem repeat homodimer, bound to cyclic peptide | | Authors: | Kennedy, M.A., Stoddard, B.L., Said, M. | | Deposition date: | 2024-02-03 |
|
| PDBID: | 9ce0 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | DosP Apo Bent form | | Authors: | Kumar, P., Kober, D.L. | | Deposition date: | 2024-06-25 |
|
| PDBID: | 8vx8 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-02-03 |
|
| PDBID: | 9cds | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of OspA ST1 from B. burgdorferi bound to monoclonal antibody LA-2 | | Authors: | Laciak, A.R., Lai, Y.-T., Dhingra, Y. | | Deposition date: | 2024-06-25 |
|
| PDBID: | 8vxh | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-04 |
|
| PDBID: | 9cdh | | Status: | PROC -- to be processed | | Deposition date: | 2024-06-25 |
|
| PDBID: | 9cdj | | Status: | PROC -- to be processed | | Deposition date: | 2024-06-25 |
|
| PDBID: | 8vxj | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-04 |
|
| PDBID: | 9cdo | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of the wild-type Thermus thermophilus 70S ribosome in complex with Fva1 antimicrobial peptide, mRNA, A-site release factor 1, and deacylated P-site and E-site tRNAphe at 2.70A resolution | | Authors: | Aleksandrova, E.V., Huang, W., Baliga, C., Atkinson, G.C., Vazquez-Laslop, N., Mankin, A.S., Polikanov, Y.S. | | Deposition date: | 2024-06-25 |
|
| PDBID: | 8vxb | | Status: | HOLD -- hold until a certain date | | Title: | Structure of ANT(6)-Ib from Campylobacter fetus subsp fetus complexed with hydrated streptomycin | | Authors: | Nalam, P., Cook, P., Smith, B. | | Deposition date: | 2024-02-04 | | Release date: | 2025-02-04 | | Sequence: | >Entity 1
MKMRTEKQIYDTILNFAKADDRIRVVTLEGSRTNINIIPDDFQDYDITFFVTDMQSFINSDEWLNVFGERLIMQKPEDMELFPKEEKGYSYLMLFWDGVKIDLTLLPLEVLDEYFTWDKLVKLLLDKDNRVTNIPVPTDEDYYIEHPTARSFDDCCNEFWNTVTYVVKGLCRKEILFAIDHLNNIVRMELLRMISWKVGIEQGYSFSLGKNYKFLERYISPELWKKILATYNMGSYTEMWKSLELCMGIFRMVSKEVAQCLNYLYPDYDKNISNYVIRQKEKYQRDPNSSSVDKLAAALEHHHHHH
|
|
| PDBID: | 9cdp | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of the wild-type Thermus thermophilus 70S ribosome in complex with Api137 antimicrobial peptide, mRNA, A-site release factor 1, and deacylated P-site and E-site tRNAphe at 2.70A resolution | | Authors: | Aleksandrova, E.V., Huang, W., Baliga, C., Atkinson, G.C., Vazquez-Laslop, N., Mankin, A.S., Polikanov, Y.S. | | Deposition date: | 2024-06-25 |
|
| PDBID: | 8vxo | | Status: | HOLD -- hold until a certain date | | Title: | Cryo-EM structure of modified JEV virus E protein dimer | | Authors: | Galkin, A., Pozharski, E., Li, Y. | | Deposition date: | 2024-02-05 | | Release date: | 2025-02-05 |
|
| PDBID: | 8vxk | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal Structure of the Apo Bacillus subtilis GabR C-terminal Effector-binding and Oligomerization Domain | | Authors: | Kaley, N.E., Liu, D. | | Deposition date: | 2024-02-05 |
|
| PDBID: | 9cdx | | Status: | PROC -- to be processed | | Title: | Crystal structure of DLK with inhibitor bound | | Authors: | Skene, R.J., Bell, J.A. | | Deposition date: | 2024-06-25 |
|
| PDBID: | 8vxm | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-05 |
|
| PDBID: | 9cdk | | Status: | HPUB -- hold until publication | | Title: | SARS-CoV-2 Mpro A173V mutant in complex with small molecule inhibitor Mpro61 | | Authors: | Tang, S., Kenneson, J.R., Anderson, K.S. | | Deposition date: | 2024-06-25 |
|
| PDBID: | 9cdl | | Status: | HPUB -- hold until publication | | Title: | SARS-CoV-2 Mpro E166V/L50F double mutant in complex with small molecule inhibitor Mpro61 | | Authors: | Tang, S., Kenneson, J.R., Huynh, K., Anderson, K.S. | | Deposition date: | 2024-06-25 |
|
| PDBID: | 8vxn | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-05 |
|
| PDBID: | 9cdy | | Status: | PROC -- to be processed | | Title: | Crystal structure of DLK with inhibitor bound | | Authors: | Skene, R.J., Bell, J.A. | | Deposition date: | 2024-06-25 |
|
