PDBID: | 8v1g | Status: | HPUB -- hold until publication | Deposition date: | 2023-11-20 |
|
PDBID: | 8x67 | Status: | HPUB -- hold until publication | Title: | solution structure of Pru p 7 | Authors: | Zheng, J., Aizawa, T., Kumeta, H. | Deposition date: | 2023-11-20 | Sequence: | >Entity 1 GSSFCDSKCGVRCSKAGYQERCLKYCGICCEKCHCVPSGTYGNKDECPCYRDLKNSKGNPKCP
|
|
PDBID: | 8x60 | Status: | HPUB -- hold until publication | Deposition date: | 2023-11-20 |
|
PDBID: | 8x68 | Status: | HPUB -- hold until publication | Title: | Complex structure of AtHPPD with YH21002 | Authors: | Yang, G.-F., Lin, H.-Y., Dong, J. | Deposition date: | 2023-11-20 |
|
PDBID: | 8x65 | Status: | HPUB -- hold until publication | Title: | Crystal structure of X11P(P71T) xylanase from a metagenome derived gene from sugarcane bagasse collection site | Authors: | Chitnumsub, P., Jaruwat, A., Boonyapakron, K., Prabmark, K. | Deposition date: | 2023-11-20 | Sequence: | >Entity 1 MAQQCITSSQTGNHGGYFYSFWTDGGGSVSFCLQNGGRYTSQWSNVGNWVGGKGWQTGGRRVVSYSGTFNTSGNSYLALYGWTTNPLVEYYIVDSWGTWRPPGGEGYMGTVFSDGGWYDVYRTQRVNAPSIEGIRTFYQYWSVRQQKRVGGTITTGNHFDAWASYGMNLGTHNYMVMATEGFQSSGSSDITVSDGGSSSLEHHHHHH
|
|
PDBID: | 8x66 | Status: | HPUB -- hold until publication | Title: | Crystal structure of triple mutant X11P(P71T+N13F+Q34L) xylanase from a metagenome derived gene from sugarcane bagasse collection site | Authors: | Chitnumsub, P., Jaruwat, A., Boonyapakron, K., Prabmark, K. | Deposition date: | 2023-11-20 | Sequence: | >Entity 1 MAQQCITSSQTGFHGGYFYSFWTDGGGSVSFCLLNGGRYTSQWSNVGNWVGGKGWQTGGRRVVSYSGTFNTSGNSYLALYGWTTNPLVEYYIVDSWGTWRPPGGEGYMGTVFSDGGWYDVYRTQRVNAPSIEGIRTFYQYWSVRQQKRVGGTITTGNHFDAWASYGMNLGTHNYMVMATEGFQSSGSSDITVSDGGSSSLEHHHHHH
|
|
PDBID: | 8x62 | Status: | HPUB -- hold until publication | Title: | crystal structure of human Mcl-1 kinase domain in complex with RM1 | Authors: | Zhang, Z.M., Wang, L. | Deposition date: | 2023-11-20 |
|
PDBID: | 8x69 | Status: | HPUB -- hold until publication | Title: | Complex structure of AtHPPD with YH23010 | Authors: | Yang, G.-F., Lin, H.-Y., Dong, J. | Deposition date: | 2023-11-20 |
|
PDBID: | 8x6a | Status: | HPUB -- hold until publication | Title: | Complex structure of AtHPPD with Y18992 | Authors: | Yang, G.-F., Lin, H.-Y., Dong, J. | Deposition date: | 2023-11-20 |
|
PDBID: | 8r66 | Status: | HPUB -- hold until publication | Title: | Crystal structure of ThsA Macro domain in complex with signaling molecule | Authors: | Tamulaitiene, G., Sabonis, D. | Deposition date: | 2023-11-21 |
|
PDBID: | 8r69 | Status: | HPUB -- hold until publication | Deposition date: | 2023-11-21 |
|
PDBID: | 8r68 | Status: | HPUB -- hold until publication | Title: | Zorya anti-bacteriophage defense system ZorC WT | Authors: | Hu, H., Taylor, N.M.I. | Deposition date: | 2023-11-21 |
|
PDBID: | 8v1w | Status: | HPUB -- hold until publication | Deposition date: | 2023-11-21 |
|
PDBID: | 8v1v | Status: | HPUB -- hold until publication | Deposition date: | 2023-11-21 |
|
PDBID: | 8v22 | Status: | HPUB -- hold until publication | Deposition date: | 2023-11-21 |
|
PDBID: | 8v1z | Status: | AUTH -- processed, waiting for author review and approval | Title: | Structure of monoclonal antibody 1A05 in complex with BA.1 RBD | Authors: | Bajic, G., Alesandro, C. | Deposition date: | 2023-11-21 |
|
PDBID: | 8v1u | Status: | HPUB -- hold until publication | Deposition date: | 2023-11-21 |
|
PDBID: | 8v23 | Status: | HPUB -- hold until publication | Title: | Crystal structure of HIV-1 capsid N-terminal domain in the presence of Lenacapavir | Authors: | Briganti, L., Kvaratskhelia, M. | Deposition date: | 2023-11-21 |
|
PDBID: | 8v1x | Status: | HPUB -- hold until publication | Title: | Crystal structure of polyketide synthase (PKS) thioreductase domain from Streptomyces coelicolor | Authors: | Pereira, J.H., Dan, Q., Keasling, J., Adams, P.D. | Deposition date: | 2023-11-21 |
|
PDBID: | 8v1y | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2023-11-21 |
|
PDBID: | 8x6e | Status: | HOLD -- hold until a certain date | Title: | crystal structure of the N-terminal TBF1 | Authors: | Gao, Y., Niu, L.W. | Deposition date: | 2023-11-21 | Release date: | 2024-11-21 |
|
PDBID: | 8x6d | Status: | HOLD -- hold until a certain date | Title: | Crystal structure of the C-terminal TBF1 | Authors: | Gao, Y., Niu, L.W. | Deposition date: | 2023-11-21 | Release date: | 2024-11-21 |
|
PDBID: | 8x6l | Status: | HPUB -- hold until publication | Deposition date: | 2023-11-21 |
|
PDBID: | 8x6k | Status: | HPUB -- hold until publication | Deposition date: | 2023-11-21 |
|
PDBID: | 8x6j | Status: | HPUB -- hold until publication | Title: | The X-ray structure of N-terminal catalytic domain of Thermoplasma acidophilum tRNA methyltransferase Trm56 (Ta0931) in complex with S-adenosyl-L-methionine | Authors: | Fukumoto, S., Hasegawa, T., Ototake, M., Moriguchi, S., Namba, M., Yamagamai, R., Kawamura, T., Hirata, A., Hori, H. | Deposition date: | 2023-11-21 |
|