| PDBID: | 8qg7 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of NAD kinase 1 from Listeria monocytogenes in complex with a di-adenosine derivative | | Authors: | Gelin, M., Labesse, G., Lionne, C. | | Deposition date: | 2023-09-05 |
|
| PDBID: | 8qg8 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of NAD kinase 1 from Listeria monocytogenes in complex with a di-adenosine derivative | | Authors: | Gelin, M., Labesse, G., Lionne, C. | | Deposition date: | 2023-09-05 |
|
| PDBID: | 8qg9 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of NAD kinase 1 from Listeria monocytogenes in complex with a di-adenosine derivative | | Authors: | Gelin, M., Labesse, G., Lionne, C. | | Deposition date: | 2023-09-05 |
|
| PDBID: | 8qga | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of NAD kinase 1 from Listeria monocytogenes in complex with a di-adenosine derivative | | Authors: | Gelin, M., Labesse, G., Lionne, C. | | Deposition date: | 2023-09-05 |
|
| PDBID: | 8qgb | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of NAD kinase 1 from Listeria monocytogenes in complex with a di-adenosine derivative | | Authors: | Gelin, M., Labesse, G., Lionne, C. | | Deposition date: | 2023-09-05 |
|
| PDBID: | 8qgc | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of NAD kinase 1 from Listeria monocytogenes in complex with a di-adenosine derivative | | Authors: | Gelin, M., Labesse, G., Lionne, C. | | Deposition date: | 2023-09-05 |
|
| PDBID: | 8qgg | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of NAD kinase 1 from Listeria monocytogenes in complex with a di-adenosine derivative | | Authors: | Gelin, M., Labesse, G., Lionne, C. | | Deposition date: | 2023-09-05 |
|
| PDBID: | 8qgh | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of NAD kinase 1 from Listeria monocytogenes in complex with a di-adenosine derivative | | Authors: | Gelin, M., Labesse, G., Lionne, C. | | Deposition date: | 2023-09-05 |
|
| PDBID: | 8qgi | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of NAD kinase 1 from Listeria monocytogenes in complex with a di-adenosine derivative | | Authors: | Gelin, M., Labesse, G., Lionne, C. | | Deposition date: | 2023-09-05 |
|
| PDBID: | 8qgj | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of NAD kinase 1 from Listeria monocytogenes in complex with a di-adenosine derivative | | Authors: | Gelin, M., Labesse, G., Lionne, C. | | Deposition date: | 2023-09-05 |
|
| PDBID: | 8qgk | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of NAD kinase 1 from Listeria monocytogenes in complex with a di-adenosine derivative | | Authors: | Gelin, M., Labesse, G., Lionne, C. | | Deposition date: | 2023-09-05 |
|
| PDBID: | 8qgl | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of NAD kinase 1 from Listeria monocytogenes in complex with a di-adenosine derivative | | Authors: | Gelin, M., Labesse, G., Lionne, C. | | Deposition date: | 2023-09-05 |
|
| PDBID: | 8qgm | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of NAD kinase 1 from Listeria monocytogenes in complex with a di-adenosine derivative | | Authors: | Gelin, M., Labesse, G., Lionne, C. | | Deposition date: | 2023-09-05 |
|
| PDBID: | 8qgn | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of NAD kinase 1 from Listeria monocytogenes in complex with a di-adenosine derivative | | Authors: | Gelin, M., Labesse, G., Lionne, C. | | Deposition date: | 2023-09-05 |
|
| PDBID: | 8qgo | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of NAD kinase 1 from Listeria monocytogenes in complex with a di-adenosine derivative | | Authors: | Gelin, M., Labesse, G., Lionne, C. | | Deposition date: | 2023-09-05 |
|
| PDBID: | 8qgp | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-05 | | Release date: | 2025-03-11 |
|
| PDBID: | 8qgq | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-05 | | Release date: | 2025-03-09 |
|
| PDBID: | 8qgv | | Status: | HPUB -- hold until publication | | Title: | Human Carbonic Anhydrase I in complex with 4-(5-acetyl-6-methyl-2-oxo-1,2,3,4-tetrahydropyrimidin-4-yl)benzenesulfonamide | | Authors: | Angeli, A., Ferraroni, M. | | Deposition date: | 2023-09-05 | | Sequence: | >Entity 1
MASPDWGYDDKNGPEQWSKLYPIANGNNQSPVDIKTSETKHDTSLKPISVSYNPATAKEIINVGHSFHVNFEDNDNRSVLKGGPFSDSYRLFQFHFHWGSTNEHGSEHTVDGVKYSAELHVAHWNSAKYSSLAEAASKADGLAVIGVLMKVGEANPKLQKVLDALQAIKTKGKRAPFTNFDPSTLLPSSLDFWTYPGSLTHPPLYESVTWIICKESISVSSEQLAQFRSLLSNVEGDNAVPMQHNNRPTQPLKGRTVRASF
|
|
| PDBID: | 8qgr | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-05 |
|
| PDBID: | 8qgd | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-05 | | Release date: | 2025-03-11 |
|
| PDBID: | 8qge | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of NAD kinase 1 from Listeria monocytogenes in complex with a di-adenosine derivative | | Authors: | Gelin, M., Labesse, G., Lionne, C. | | Deposition date: | 2023-09-05 |
|
| PDBID: | 8qfv | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-05 |
|
| PDBID: | 8u25 | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of SARS-CoV-2 Main Protease (Mpro) L50F/E166A/L167F Triple Mutant | | Authors: | Kohaal, N., Lewandowski, E.M., Wang, J., Chen, Y. | | Deposition date: | 2023-09-05 |
|
| PDBID: | 8u2a | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-09-05 | | Release date: | 2024-09-05 |
|
| PDBID: | 8w99 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-05 |
|
