PDBID: | 8x65 | Status: | HPUB -- hold until publication | Title: | Crystal structure of X11P(P71T) xylanase from a metagenome derived gene from sugarcane bagasse collection site | Authors: | Chitnumsub, P., Jaruwat, A., Boonyapakron, K., Prabmark, K. | Deposition date: | 2023-11-20 | Sequence: | >Entity 1 MAQQCITSSQTGNHGGYFYSFWTDGGGSVSFCLQNGGRYTSQWSNVGNWVGGKGWQTGGRRVVSYSGTFNTSGNSYLALYGWTTNPLVEYYIVDSWGTWRPPGGEGYMGTVFSDGGWYDVYRTQRVNAPSIEGIRTFYQYWSVRQQKRVGGTITTGNHFDAWASYGMNLGTHNYMVMATEGFQSSGSSDITVSDGGSSSLEHHHHHH
|
|
PDBID: | 9eyk | Status: | HPUB -- hold until publication | Deposition date: | 2024-04-09 |
|
PDBID: | 8x66 | Status: | HPUB -- hold until publication | Title: | Crystal structure of triple mutant X11P(P71T+N13F+Q34L) xylanase from a metagenome derived gene from sugarcane bagasse collection site | Authors: | Chitnumsub, P., Jaruwat, A., Boonyapakron, K., Prabmark, K. | Deposition date: | 2023-11-20 | Sequence: | >Entity 1 MAQQCITSSQTGFHGGYFYSFWTDGGGSVSFCLLNGGRYTSQWSNVGNWVGGKGWQTGGRRVVSYSGTFNTSGNSYLALYGWTTNPLVEYYIVDSWGTWRPPGGEGYMGTVFSDGGWYDVYRTQRVNAPSIEGIRTFYQYWSVRQQKRVGGTITTGNHFDAWASYGMNLGTHNYMVMATEGFQSSGSSDITVSDGGSSSLEHHHHHH
|
|
PDBID: | 9ey0 | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2024-04-09 |
|
PDBID: | 8x62 | Status: | HPUB -- hold until publication | Title: | crystal structure of human Mcl-1 kinase domain in complex with RM1 | Authors: | Zhang, Z.M., Wang, L. | Deposition date: | 2023-11-20 |
|
PDBID: | 8x69 | Status: | HPUB -- hold until publication | Title: | Complex structure of AtHPPD with YH23010 | Authors: | Yang, G.-F., Lin, H.-Y., Dong, J. | Deposition date: | 2023-11-20 |
|
PDBID: | 9ey1 | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2024-04-09 |
|
PDBID: | 9ey2 | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2024-04-09 |
|
PDBID: | 8x6a | Status: | AUTH -- processed, waiting for author review and approval | Title: | Complex structure of AtHPPD with Y18992 | Authors: | Yang, G.-F., Lin, H.-Y., Dong, J. | Deposition date: | 2023-11-20 |
|
PDBID: | 9eyh | Status: | HPUB -- hold until publication | Deposition date: | 2024-04-09 |
|
PDBID: | 9eyl | Status: | HPUB -- hold until publication | Deposition date: | 2024-04-09 |
|
PDBID: | 8je8 | Status: | AUTH -- processed, waiting for author review and approval | Title: | Cryo-EM Structure of the apo HCAR3-Gi complex | Authors: | Fang, Y., Pan, X. | Deposition date: | 2023-05-15 | Release date: | 2024-11-15 |
|
PDBID: | 8x6e | Status: | HOLD -- hold until a certain date | Title: | crystal structure of the N-terminal TBF1 | Authors: | Gao, Y., Niu, L.W. | Deposition date: | 2023-11-21 | Release date: | 2024-11-21 |
|
PDBID: | 9eyd | Status: | HPUB -- hold until publication | Deposition date: | 2024-04-09 |
|
PDBID: | 8je5 | Status: | HOLD -- hold until a certain date | Deposition date: | 2023-05-15 | Release date: | 2024-11-15 |
|
PDBID: | 8x6d | Status: | HOLD -- hold until a certain date | Title: | Crystal structure of the C-terminal TBF1 | Authors: | Gao, Y., Niu, L.W. | Deposition date: | 2023-11-21 | Release date: | 2024-11-21 |
|
PDBID: | 9eym | Status: | HPUB -- hold until publication | Title: | The structure of solubilized octameric pore of actinoporin Fav prepared on DOPC:sphingomyelin membranes | Authors: | Solinc, G., Srnko, M., Svigel, T., Anderluh, G., Podobnik, M. | Deposition date: | 2024-04-09 |
|
PDBID: | 8je6 | Status: | HOLD -- hold until a certain date | Deposition date: | 2023-05-15 | Release date: | 2024-11-15 |
|
PDBID: | 8x6l | Status: | HPUB -- hold until publication | Deposition date: | 2023-11-21 |
|
PDBID: | 9eyn | Status: | HPUB -- hold until publication | Deposition date: | 2024-04-09 |
|
PDBID: | 8je7 | Status: | HOLD -- hold until a certain date | Deposition date: | 2023-05-15 | Release date: | 2024-11-15 |
|
PDBID: | 8x6k | Status: | HPUB -- hold until publication | Deposition date: | 2023-11-21 |
|
PDBID: | 9eyo | Status: | HPUB -- hold until publication | Deposition date: | 2024-04-09 |
|
PDBID: | 8jef | Status: | AUTH -- processed, waiting for author review and approval | Title: | Cryo-EM Structure of the 3HO-HCAR3-Gi complex | Authors: | Fang, Y., Pan, X. | Deposition date: | 2023-05-15 | Release date: | 2024-11-15 |
|
PDBID: | 8x6j | Status: | HPUB -- hold until publication | Title: | The X-ray structure of N-terminal catalytic domain of Thermoplasma acidophilum tRNA methyltransferase Trm56 (Ta0931) in complex with S-adenosyl-L-methionine | Authors: | Fukumoto, S., Hasegawa, T., Ototake, M., Moriguchi, S., Namba, M., Yamagamai, R., Kawamura, T., Hirata, A., Hori, H. | Deposition date: | 2023-11-21 |
|