PDBID: | 9bjs | Status: | HPUB -- hold until publication | Deposition date: | 2024-04-25 |
|
PDBID: | 9bjt | Status: | HPUB -- hold until publication | Deposition date: | 2024-04-25 |
|
PDBID: | 9bjf | Status: | HPUB -- hold until publication | Deposition date: | 2024-04-25 |
|
PDBID: | 9bjc | Status: | HPUB -- hold until publication | Deposition date: | 2024-04-25 |
|
PDBID: | 9bjd | Status: | WAIT -- processing started, waiting for author input to continue processing | Deposition date: | 2024-04-25 |
|
PDBID: | 9bjj | Status: | HPUB -- hold until publication | Deposition date: | 2024-04-25 |
|
PDBID: | 9bje | Status: | HPUB -- hold until publication | Deposition date: | 2024-04-25 |
|
PDBID: | 9bjg | Status: | HPUB -- hold until publication | Deposition date: | 2024-04-25 |
|
PDBID: | 9bjh | Status: | HPUB -- hold until publication | Deposition date: | 2024-04-25 |
|
PDBID: | 9bji | Status: | HPUB -- hold until publication | Deposition date: | 2024-04-25 |
|
PDBID: | 9bj8 | Status: | REPL -- author sent new coordinates, entry to be reprocessed | Title: | human CRL2-ZYG11B complex | Authors: | Liu, X., Gross, J.D. | Deposition date: | 2024-04-25 |
|
PDBID: | 9bj9 | Status: | AUTH -- processed, waiting for author review and approval | Title: | Human CRL-2 ZYG11B binding to human NLRP1 Gly/N degron | Authors: | Liu, X., Gross, J.D. | Deposition date: | 2024-04-25 |
|
PDBID: | 9bjn | Status: | HPUB -- hold until publication | Title: | Cryo-EM of Azo-ffspy fiber | Authors: | Zia, A., Guo, J., Xu, B., Wang, F. | Deposition date: | 2024-04-25 |
|
PDBID: | 9bjo | Status: | HPUB -- hold until publication | Title: | Cryo-EM of Azo-ffsy fiber | Authors: | Zia, A., Guo, J., Xu, B., Wang, F. | Deposition date: | 2024-04-25 |
|
PDBID: | 9bjw | Status: | AUTH -- processed, waiting for author review and approval | Title: | Crystal structure of RidA family protein PA5083 from Pseudomonas aeruginosa | Authors: | Zhou, D., Chen, L., Rose, J.P., Wang, B.C. | Deposition date: | 2024-04-25 |
|
PDBID: | 9bjx | Status: | HPUB -- hold until publication | Deposition date: | 2024-04-25 |
|
PDBID: | 9bjv | Status: | AUTH -- processed, waiting for author review and approval | Title: | Crystal structure of hypothetical protein PA5083 from Pseudomonas aeruginosa Sulfur SAD phased | Authors: | Zhou, D., Chen, L., Rose, J.P., Wang, B.C. | Deposition date: | 2024-04-25 |
|
PDBID: | 9f4b | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2024-04-26 |
|
PDBID: | 9f4a | Status: | HPUB -- hold until publication | Deposition date: | 2024-04-26 |
|
PDBID: | 9f3v | Status: | HPUB -- hold until publication | Deposition date: | 2024-04-26 |
|
PDBID: | 9f46 | Status: | HPUB -- hold until publication | Deposition date: | 2024-04-26 |
|
PDBID: | 9f3u | Status: | HPUB -- hold until publication | Deposition date: | 2024-04-26 |
|
PDBID: | 9f47 | Status: | HPUB -- hold until publication | Deposition date: | 2024-04-26 |
|
PDBID: | 9f49 | Status: | HOLD -- hold until a certain date | Title: | Structure of the bacteriophage K gp155 C-terminal domain, seleno-methionine modified version | Authors: | Pichel, A., van Raaij, M.J. | Deposition date: | 2024-04-26 | Release date: | 2024-06-21 | Sequence: | >Entity 1 KDF(MSE)LIGHRGATGYTDEHTIKGYQ(MSE)ALDKGADYIELDLQLTKDNKLLC(MSE)HDSTIDRTTTGTGKVGD(MSE)TLSYIQTNFTSLNGEPIPSLDDVLNHFGTKVKYYIETKRPFDAN(MSE)DRELLTQLKAKGLIGIGSERFQVIIQSFARESLINIHNQFSNIPLAYLTSTFSESE(MSE)DDCLSYGFYAIAPKYTTITKELVDLAHSKGLKVHAWTVNTKEE(MSE)QSLIQ(MSE)GVDGFFTNYLDEYKKI
|
|
PDBID: | 8zb6 | Status: | HPUB -- hold until publication | Title: | Yeast-expressed polio type 2 stabilized virus-like particles | Authors: | Hong, Q., Cong, Y. | Deposition date: | 2024-04-26 |
|