| PDBID: | 9ep0 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-16 |
|
| PDBID: | 9ep2 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the complex of human carbonic anhydrase I with 4-sulfamoylphenyl 3-(p-tolylthio)propanoate | | Authors: | Angeli, A., Ferraroni, M. | | Deposition date: | 2024-03-16 | | Sequence: | >Entity 1
MASPDWGYDDKNGPEQWSKLYPIANGNNQSPVDIKTSETKHDTSLKPISVSYNPATAKEIINVGHSFHVNFEDNDNRSVLKGGPFSDSYRLFQFHFHWGSTNEHGSEHTVDGVKYSAELHVAHWNSAKYSSLAEAASKADGLAVIGVLMKVGEANPKLQKVLDALQAIKTKGKRAPFTNFDPSTLLPSSLDFWTYPGSLTHPPLYESVTWIICKESISVSSEQLAQFRSLLSNVEGDNAVPMQHNNRPTQPLKGRTVRASF
|
|
| PDBID: | 8xaa | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-03 |
|
| PDBID: | 9ep6 | | Status: | HPUB -- hold until publication | | Title: | Alpha-Galactosaminidase family GH114 from Fusarium solani | | Authors: | Roth, C., Moroz, O.V., Miranda, S.A.D., Jahn, L., Blagova, E., Lebedev, A.A., Segura, D.R., Stringer, M.A., Friis, E.P., Davies, G.J., Wilson, K.S. | | Deposition date: | 2024-03-17 |
|
| PDBID: | 8xac | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of amidase from Pseudonocardia acaciae | | Authors: | Takenoya, M., Yajima, S. | | Deposition date: | 2023-12-03 |
|
| PDBID: | 9ep7 | | Status: | HPUB -- hold until publication | | Title: | Poecitoxin-1a from Poecilotheria subfusca spider, a new potent peptide blocker of the human Cav1.2 channel subtype | | Authors: | Kurz, M., Kurz, M. | | Deposition date: | 2024-03-18 |
|
| PDBID: | 8x6x | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-22 |
|
| PDBID: | 8j3f | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2023-04-16 | | Release date: | 2024-10-16 |
|
| PDBID: | 9epf | | Status: | WAIT -- processing started, waiting for author input to continue processing | | Title: | Human Picobirnavirus CP VLP | | Authors: | Rodriguez-Espinosa, M.J., Novoa, G., Martinez-Romero, J.M., de Pablo, P.J., Caston, J.R. | | Deposition date: | 2024-03-18 |
|
| PDBID: | 8x6w | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-22 |
|
| PDBID: | 8j3g | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2023-04-16 | | Release date: | 2024-10-16 |
|
| PDBID: | 9epd | | Status: | HPUB -- hold until publication | | Title: | DtpAa Y389F 8 fs 10 microjoules XFEL Pulse Data Collection | | Authors: | Williams, L.J., Owen, R.L., Worrall, J.A.R., Hough, M.A. | | Deposition date: | 2024-03-18 |
|
| PDBID: | 8x6s | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | FMDV (A/TUR/14/98) in complex with M688F | | Authors: | Li, H.Z., Dong, H., Liu, P. | | Deposition date: | 2023-11-22 |
|
| PDBID: | 8j3h | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2023-04-16 | | Release date: | 2024-10-16 |
|
| PDBID: | 9epg | | Status: | HPUB -- hold until publication | | Title: | DtpAa Y389F 24 fs 10 microjoules XFEL Pulse Data Collection | | Authors: | Williams, L.J., Owen, R.L., Worrall, J.A.R., Hough, M.A. | | Deposition date: | 2024-03-18 |
|
| PDBID: | 8x6t | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of Peroxiredoxin I in complex with Lithospermic Acid | | Authors: | Zhang, H., Luo, C. | | Deposition date: | 2023-11-22 |
|
| PDBID: | 8j3i | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2023-04-16 | | Release date: | 2024-10-16 |
|
| PDBID: | 9eph | | Status: | HPUB -- hold until publication | | Title: | DtpAa Y389F 53 fs 100 microjoules XFEL Pulse Data Collection | | Authors: | Williams, L.J., Owen, R.L., Worrall, J.A.R., Hough, M.A. | | Deposition date: | 2024-03-18 |
|
| PDBID: | 8j33 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of SARS main protease in complex with PF00835231 | | Authors: | Zhou, X.L., Lin, C., Zou, X.F., Zhang, J., Li, J. | | Deposition date: | 2023-04-16 | | Release date: | 2024-10-16 |
|
| PDBID: | 8x74 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of ZmHSL1A complexed with mesotrione | | Authors: | Lin, H.-Y., Dong, J., Yang, G.-F. | | Deposition date: | 2023-11-22 |
|
| PDBID: | 9epi | | Status: | HPUB -- hold until publication | | Title: | DtpAa Y389F 53 fs 10 microjoules XFEL Pulse Data Collection | | Authors: | Williams, L.J., Owen, R.L., Worrall, J.A.R., Hough, M.A. | | Deposition date: | 2024-03-18 |
|
| PDBID: | 8xae | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-12-04 | | Release date: | 2024-12-04 |
|
| PDBID: | 9ep8 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of ROCK2 in complex with a 8-(azaindolyl)-benzoazepinone inhibitor | | Authors: | Pala, D., Clark, D., Pioselli, B., Accetta, A., Rancati, F. | | Deposition date: | 2024-03-18 | | Sequence: | >Entity 1
GAAGDGAGASRQRKLEALIRDPRSPINVESLLDGLNSLVLDLDFPALRKNKNIDNFLNRYEKIVKKIRGLQMKAEDYDVVKVIGRGAFGEVQLVRHKASQKVYAMKLLSKFEMIKRSDSAFFWEERDIMAFANSPWVVQLFYAFQDDRYLYMVMEYMPGGDLVNLMSNYDVPEKWAKFYTAEVVLALDAIHSMGLIHRDVKPDNMLLDKHGHLKLADFGTCMKMDETGMVHCDTAVGTPDYISPEVLKSQGGDGFYGRECDWWSVGVFLYEMLVGDTPFYADSLVGTYSKIMDHKNSLCFPEDAEISKHAKNLICAFLTDREVRLGRNGVEEIRQHPFFKNDQWHWDNIRETAAPVVPELSSDIDSSNFDDIEDDKGDVETFPIPKAFVGNQLPFIGFTYYR
|
|
| PDBID: | 8xad | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-12-04 | | Release date: | 2024-12-04 |
|
| PDBID: | 9epj | | Status: | HPUB -- hold until publication | | Title: | DtpAa Y389F 41 fs 10 microjoules XFEL Pulse Data Collection | | Authors: | Williams, L.J., Owen, R.L., Worrall, J.A.R., Hough, M.A. | | Deposition date: | 2024-03-18 |
|
