PDBID: | 8rbl | Status: | HPUB -- hold until publication | Deposition date: | 2023-12-04 |
|
PDBID: | 8rbp | Status: | HPUB -- hold until publication | Title: | Crystal structure of chimeric human carbonic anhydrase IX with 4-chloro-2-(cyclohexylsulfanyl)-N-(2-hydroxyethyl)-5-sulfamoylbenzamide | Authors: | Manakova, E.N., Smirnov, A., Paketuryte, V., Grazulis, S. | Deposition date: | 2023-12-04 | Sequence: | >Entity 1 MSHHWGYGKHNGPEHWHKDFPIAKGERQSPVDIDTHTAKYDPSLKPLSVSYDQATSLRILNNGHSFQVEFDDSQDKAVLKGGPLDGTYRLLQFHFHWGSLDGQGSEHTVDKKKYAAELHLVHWNTKYGDVGKALQQPDGLAVLGIFLKVGSAKPGLQKVVDVLDSIKTKGKSADFTNFDPRGLLPESLDYWTYPGSLTTPPLAECVTWIVLKEPISVSSEQVLKFRKLNFNGEGEPEELMVDNWRPAQPLKNRQIKASFK
|
|
PDBID: | 8rbc | Status: | HPUB -- hold until publication | Title: | p53-Y220C Core Domain Covalently Bound to 3-amino-5-chloropyrazine-2,6-dicarbonitrile Soaked at 5 mM | Authors: | Stahlecker, J., Klett, T., Stehle, T., Boeckler, F.M. | Deposition date: | 2023-12-04 |
|
PDBID: | 8v7s | Status: | HPUB -- hold until publication | Deposition date: | 2023-12-04 |
|
PDBID: | 8v7p | Status: | HPUB -- hold until publication | Title: | Crystal structure of the truncated P1 pilin from Pseudomonas aeruginosa | Authors: | Bragagnolo, N.J., Audette, G.F. | Deposition date: | 2023-12-04 |
|
PDBID: | 8v7q | Status: | HPUB -- hold until publication | Title: | IpaD (122-321) Pi-helix Mutant (delta Q148) Apo Structure | Authors: | Barker, S.A., Dickenson, N.E., Johnson, S.J. | Deposition date: | 2023-12-04 |
|
PDBID: | 8v7y | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2023-12-04 |
|
PDBID: | 8v7x | Status: | HPUB -- hold until publication | Deposition date: | 2023-12-04 |
|
PDBID: | 8v6w | Status: | HPUB -- hold until publication | Deposition date: | 2023-12-04 |
|
PDBID: | 8v6x | Status: | HPUB -- hold until publication | Title: | Crystal structure of the core catalytic domain of human inositol phosphate multikinase in complex with compound 2 | Authors: | Wang, H., Shears, S.B. | Deposition date: | 2023-12-04 |
|
PDBID: | 8v6y | Status: | HPUB -- hold until publication | Title: | Crystal structure of the core catalytic domain of human inositol phosphate multikinase in complex with compound 3 | Authors: | Wang, H., Shears, S.B. | Deposition date: | 2023-12-04 |
|
PDBID: | 8v6z | Status: | HPUB -- hold until publication | Title: | Crystal structure of the core catalytic domain of human inositol phosphate multikinase in complex with compound 4 | Authors: | Wang, H., Shears, S.B. | Deposition date: | 2023-12-04 |
|
PDBID: | 8v70 | Status: | HPUB -- hold until publication | Title: | Crystal structure of the core catalytic domain of human inositol phosphate multikinase in complex with compound 6 | Authors: | Wang, H., Shears, S.B. | Deposition date: | 2023-12-04 |
|
PDBID: | 8v71 | Status: | HPUB -- hold until publication | Title: | Crystal structure of the core catalytic domain of human inositol phosphate multikinase in complex with compound 7 | Authors: | Wang, H., Shears, S.B. | Deposition date: | 2023-12-04 |
|
PDBID: | 8v72 | Status: | HPUB -- hold until publication | Title: | Crystal structure of the core catalytic domain of human inositol phosphate multikinase in complex with compound 8 | Authors: | Wang, H., Shears, S.B. | Deposition date: | 2023-12-04 |
|
PDBID: | 8v73 | Status: | HPUB -- hold until publication | Title: | Crystal structure of the core catalytic domain of human inositol phosphate multikinase in complex with compound 9 | Authors: | Wang, H., Shears, S.B. | Deposition date: | 2023-12-04 |
|
PDBID: | 8v74 | Status: | HPUB -- hold until publication | Title: | Crystal structure of the core catalytic domain of human inositol phosphate multikinase in complex with compound 10 | Authors: | Wang, H., Shears, S.B. | Deposition date: | 2023-12-04 |
|
PDBID: | 8v76 | Status: | HPUB -- hold until publication | Title: | Crystal structure of the core catalytic domain of human inositol phosphate multikinase in complex with compound 12 | Authors: | Wang, H., Shears, S.B. | Deposition date: | 2023-12-04 |
|
PDBID: | 8v77 | Status: | HPUB -- hold until publication | Title: | Crystal structure of the core catalytic domain of human inositol phosphate multikinase in complex with compound 13 | Authors: | Wang, H., Shears, S.B. | Deposition date: | 2023-12-04 |
|
PDBID: | 8v78 | Status: | HPUB -- hold until publication | Title: | Crystal structure of the core catalytic domain of human inositol phosphate multikinase in complex with compound 14 | Authors: | Wang, H., Shears, S.B. | Deposition date: | 2023-12-04 |
|
PDBID: | 8v79 | Status: | HPUB -- hold until publication | Title: | Crystal structure of the core catalytic domain of human inositol phosphate multikinase in complex with compound 15 | Authors: | Wang, H., Shears, S.B. | Deposition date: | 2023-12-04 |
|
PDBID: | 8v7n | Status: | HPUB -- hold until publication | Deposition date: | 2023-12-04 |
|
PDBID: | 8v81 | Status: | HPUB -- hold until publication | Deposition date: | 2023-12-04 |
|
PDBID: | 8v7m | Status: | HPUB -- hold until publication | Deposition date: | 2023-12-04 |
|
PDBID: | 8v7z | Status: | HPUB -- hold until publication | Deposition date: | 2023-12-04 |
|