| PDBID: | 8x9o | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Deposition date: | 2023-11-30 |
|
| PDBID: | 8iyy | | Status: | HOLD -- hold until a certain date | | Title: | Single excitation and two emissions pH sensor protein(SITE-pHorin)_pH7.0 | | Authors: | Li, S.A., Kang, J.S. | | Deposition date: | 2023-04-06 | | Release date: | 2024-10-06 |
|
| PDBID: | 9enx | | Status: | HPUB -- hold until publication | | Title: | Enmetazobactam-Derived GES-1 Acyl-Enzyme | | Authors: | Beer, M., Hinchliffe, P., Spencer, J. | | Deposition date: | 2024-03-13 |
|
| PDBID: | 9eny | | Status: | HPUB -- hold until publication | | Title: | Tazobactam-Derived GES-1 Acyl-Enzyme | | Authors: | Beer, M., Hinchliffe, P., Spencer, J. | | Deposition date: | 2024-03-13 |
|
| PDBID: | 8x5t | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-19 |
|
| PDBID: | 8iyz | | Status: | HOLD -- hold until a certain date | | Title: | mTurquoise2 S65T | | Authors: | Kang, J.S., Li, S.A. | | Deposition date: | 2023-04-06 | | Release date: | 2024-10-06 |
|
| PDBID: | 8x5u | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-19 |
|
| PDBID: | 8iz0 | | Status: | HOLD -- hold until a certain date | | Title: | mTurquoise2 W66Y | | Authors: | Li, S.A., Kang, J.S. | | Deposition date: | 2023-04-06 | | Release date: | 2024-10-06 |
|
| PDBID: | 9eno | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-13 |
|
| PDBID: | 9eo1 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-14 |
|
| PDBID: | 8x67 | | Status: | HPUB -- hold until publication | | Title: | solution structure of Pru p 7 | | Authors: | Zheng, J., Aizawa, T., Kumeta, H. | | Deposition date: | 2023-11-20 | | Sequence: | >Entity 1
GSSFCDSKCGVRCSKAGYQERCLKYCGICCEKCHCVPSGTYGNKDECPCYRDLKNSKGNPKCP
|
|
| PDBID: | 8iz2 | | Status: | HOLD -- hold until a certain date | | Title: | Single excitation and two emissions pH sensor protein (SITE-pHorin)_C203E_pH8.0 | | Authors: | Kang, J.S., Li, S.A. | | Deposition date: | 2023-04-06 | | Release date: | 2024-10-06 |
|
| PDBID: | 9eoa | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-14 |
|
| PDBID: | 8x60 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-20 |
|
| PDBID: | 9eoi | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-14 |
|
| PDBID: | 8x65 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of X11P(P71T) xylanase from a metagenome derived gene from sugarcane bagasse collection site | | Authors: | Chitnumsub, P., Jaruwat, A., Boonyapakron, K., Prabmark, K. | | Deposition date: | 2023-11-20 | | Sequence: | >Entity 1
MAQQCITSSQTGNHGGYFYSFWTDGGGSVSFCLQNGGRYTSQWSNVGNWVGGKGWQTGGRRVVSYSGTFNTSGNSYLALYGWTTNPLVEYYIVDSWGTWRPPGGEGYMGTVFSDGGWYDVYRTQRVNAPSIEGIRTFYQYWSVRQQKRVGGTITTGNHFDAWASYGMNLGTHNYMVMATEGFQSSGSSDITVSDGGSSSLEHHHHHH
|
|
| PDBID: | 8iyv | | Status: | HOLD -- hold until a certain date | | Title: | Crystal structure of trypsin-famotidine complex at 2.10 Angstroms resolution | | Authors: | Ahmad, M.S., Kalam, N., Akbar, Z., Rasheed, S., Choudhary, M.I. | | Deposition date: | 2023-04-06 | | Release date: | 2024-10-06 |
|
| PDBID: | 9eod | | Status: | HPUB -- hold until publication | | Title: | Human serum albumin with adamantene carboxylic acid | | Authors: | Freitag-Pohl, S., Pohl, E. | | Deposition date: | 2024-03-14 | | Sequence: | >Entity 1
MKWVTFISLLFLFSSAYSRGVFRRDAHKSEVAHRFKDLGEENFKALVLIAFAQYLQQCPFEDHVKLVNEVTEFAKTCVADESAENCDKSLHTLFGDKLCTVATLRETYGEMADCCAKQEPERNECFLQHKDDNPNLPRLVRPEVDVMCTAFHDNEETFLKKYLYEIARRHPYFYAPELLFFAKRYKAAFTECCQAADKAACLLPKLDELRDEGKASSAKQRLKCASLQKFGERAFKAWAVARLSQRFPKAEFAEVSKLVTDLTKVHTECCHGDLLECADDRADLAKYICENQDSISSKLKECCEKPLLEKSHCIAEVENDEMPADLPSLAADFVESKDVCKNYAEAKDVFLGMFLYEYARRHPDYSVVLLLRLAKTYETTLEKCCAAADPHECYAKVFDEFKPLVEEPQNLIKQNCELFEQLGEYKFQNALLVRYTKKVPQVSTPTLVEVSRNLGKVGSKCCKHPEAKRMPCAEDYLSVVLNQLCVLHEKTPVSDRVTKCCTESLVNRRPCFSALEVDETYVPKEFNAETFTFHADICTLSEKERQIKKQTALVELVKHKPKATKEQLKAVMDDFAAFVEKCCKADDKETCFAEEGKKLVAASQAALGLL
|
|
| PDBID: | 8x66 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of triple mutant X11P(P71T+N13F+Q34L) xylanase from a metagenome derived gene from sugarcane bagasse collection site | | Authors: | Chitnumsub, P., Jaruwat, A., Boonyapakron, K., Prabmark, K. | | Deposition date: | 2023-11-20 | | Sequence: | >Entity 1
MAQQCITSSQTGFHGGYFYSFWTDGGGSVSFCLLNGGRYTSQWSNVGNWVGGKGWQTGGRRVVSYSGTFNTSGNSYLALYGWTTNPLVEYYIVDSWGTWRPPGGEGYMGTVFSDGGWYDVYRTQRVNAPSIEGIRTFYQYWSVRQQKRVGGTITTGNHFDAWASYGMNLGTHNYMVMATEGFQSSGSSDITVSDGGSSSLEHHHHHH
|
|
| PDBID: | 8izq | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Multidrug resistance-associated protein 3 | | Authors: | Yun, C.H., Gao, H.M. | | Deposition date: | 2023-04-07 | | Release date: | 2024-11-07 |
|
| PDBID: | 9eoy | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2024-03-15 | | Release date: | 2025-03-15 |
|
| PDBID: | 8x6l | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-21 |
|
| PDBID: | 8izi | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-04-07 | | Release date: | 2024-10-07 |
|
| PDBID: | 9eol | | Status: | HPUB -- hold until publication | | Title: | N-acetylglucosamine 6-phosphate dehydratase: inhibited 6-phosphogluconic acid state of NagS | | Authors: | McNae, I.W., Abrahams, J.P., Li, C. | | Deposition date: | 2024-03-15 |
|
| PDBID: | 8x9s | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2023-12-01 |
|
