| PDBID: | 8x9x | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | C-hexon capsomer of the VZV C-Capsid | | Authors: | Nan, W., Lei, C., Xiangxi, W. | | Deposition date: | 2023-12-01 |
|
| PDBID: | 8x9w | | Status: | WAIT -- processing started, waiting for author input to continue processing | | Title: | portal vertex capsomer of the VZV C-Capsid | | Authors: | Nan, W., Lei, C., Jiangxi, W. | | Deposition date: | 2023-12-01 |
|
| PDBID: | 8xa7 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-02 |
|
| PDBID: | 8xa8 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-02 |
|
| PDBID: | 8xa6 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-02 |
|
| PDBID: | 8xa5 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-02 |
|
| PDBID: | 8xaa | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-03 |
|
| PDBID: | 8xac | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of amidase from Pseudonocardia acaciae | | Authors: | Takenoya, M., Yajima, S. | | Deposition date: | 2023-12-03 |
|
| PDBID: | 8xah | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-04 |
|
| PDBID: | 8xal | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of SARS-CoV-2 S-BQ.1 in complex with ACE2 | | Authors: | Hsu, H.F., Wu, M.H., Chang, Y.C., Hsu, S.T.D. | | Deposition date: | 2023-12-04 |
|
| PDBID: | 8xae | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-12-04 | | Release date: | 2024-12-04 |
|
| PDBID: | 8xad | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-12-04 | | Release date: | 2024-12-04 |
|
| PDBID: | 8xaf | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-12-04 | | Release date: | 2024-12-04 |
|
| PDBID: | 8xag | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-04 |
|
| PDBID: | 8rbk | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-04 |
|
| PDBID: | 8rbh | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-04 |
|
| PDBID: | 8rba | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-04 |
|
| PDBID: | 8rbf | | Status: | HPUB -- hold until publication | | Title: | CryoEM structure of the post-powerstroke actomyosin-5a complex | | Authors: | Klebl, D.P., McMillan, S.N., Risi, C., Forgacs, E., Virok, B., Atherton, J.L., Stofella, M., Winkelmann, D.A., Sobott, F., Galkin, V.E., Knight, P.J., Muench, S.P., Scarff, C.A., White, H.D. | | Deposition date: | 2023-12-04 |
|
| PDBID: | 8rbb | | Status: | HPUB -- hold until publication | | Title: | p53-Y220C Core Domain Covalently Bound to 2,5,6-trifluoropyridine-3-carbonitrile Soaked at 40 mM | | Authors: | Stahlecker, J., Klett, T., Stehle, T., Boeckler, F.M. | | Deposition date: | 2023-12-04 |
|
| PDBID: | 8rbg | | Status: | HPUB -- hold until publication | | Title: | CryoEM structure of primed myosin-5a (ADP-Pi state) | | Authors: | Klebl, D.P., McMillan, S.N., Risi, C., Forgacs, E., Virok, B., Atherton, J.L., Stofella, M., Winkelmann, D.A., Sobott, F., Galkin, V.E., Knight, P.J., Muench, S.P., Scarff, C.A., White, H.D. | | Deposition date: | 2023-12-04 |
|
| PDBID: | 8rbe | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-04 |
|
| PDBID: | 8rbj | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-04 |
|
| PDBID: | 8rbd | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-04 |
|
| PDBID: | 8rbl | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-04 |
|
| PDBID: | 8rbp | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of chimeric human carbonic anhydrase IX with 4-chloro-2-(cyclohexylsulfanyl)-N-(2-hydroxyethyl)-5-sulfamoylbenzamide | | Authors: | Manakova, E.N., Smirnov, A., Paketuryte, V., Grazulis, S. | | Deposition date: | 2023-12-04 | | Sequence: | >Entity 1
MSHHWGYGKHNGPEHWHKDFPIAKGERQSPVDIDTHTAKYDPSLKPLSVSYDQATSLRILNNGHSFQVEFDDSQDKAVLKGGPLDGTYRLLQFHFHWGSLDGQGSEHTVDKKKYAAELHLVHWNTKYGDVGKALQQPDGLAVLGIFLKVGSAKPGLQKVVDVLDSIKTKGKSADFTNFDPRGLLPESLDYWTYPGSLTTPPLAECVTWIVLKEPISVSSEQVLKFRKLNFNGEGEPEELMVDNWRPAQPLKNRQIKASFK
|
|
