| PDBID: | 8whd | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-23 |
|
| PDBID: | 8whc | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-23 |
|
| PDBID: | 8whe | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2023-09-23 |
|
| PDBID: | 8whg | | Status: | HPUB -- hold until publication | | Title: | imine reductase mutant - M3 | | Authors: | Zhu, X.X., Chen, X.R., Zheng, G.W. | | Deposition date: | 2023-09-23 |
|
| PDBID: | 8whf | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-23 |
|
| PDBID: | 8whi | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-23 |
|
| PDBID: | 8whj | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-23 |
|
| PDBID: | 8whk | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-23 |
|
| PDBID: | 8whl | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-23 |
|
| PDBID: | 8whm | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the ELKS2/LL5beta complex | | Authors: | Jia, X., Wei, Z. | | Deposition date: | 2023-09-23 |
|
| PDBID: | 8who | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of AtHPPD-YH20541 complex | | Authors: | Yang, G.-F., Lin, H.-Y., Dong, J. | | Deposition date: | 2023-09-23 |
|
| PDBID: | 8whp | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of AtHPPD-YH201042 complex | | Authors: | Yang, G.-F., Lin, H.-Y., Dong, J. | | Deposition date: | 2023-09-23 |
|
| PDBID: | 8whq | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of AtHPPD-YH21398 complex | | Authors: | Yang, G.-F., Lin, H.-Y., Dong, J. | | Deposition date: | 2023-09-23 | | Sequence: | >Entity 1
GSHMVRKNPKSDKFKVKRFHHIEFWCGDATNVARRFSWGLGMRFSAKSDLSTGNMVHASYLLTSGDLRFLFTAPYSPSLSAGEIKPTTTASIPSFDHGSCRSFFSSHGLGVRAVAIEVEDAESAFSISVANGAIPSSPPIVLNEAVTIAEVKLYGDVVLRYVSYKAEDTEKSEFLPGFERVEDASSFPLDYGIRRLDHAVGNVPELGPALTYVAGFTGFHQFAEFTADDVGTAESGLNSAVLASNDEMVLLPINEPVHGTKRKSQIQTYLEHNEGAGLQHLALMSEDIFRTLREMRKRSSIGGFDFMPSPPPTYYQNLKKRVGDVLSDDQIKECEELGILVDRDDQGTLLQIFTKPLGDRPTIFIEIIQRVGCMMKDEEGKAYQSGGCGGFGKGNFSELFKSIEEYEKTLEAKQLVG
|
|
| PDBID: | 8wi6 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of AtHPPD-ZSM824 complex | | Authors: | Yang, G.-F., Lin, H.-Y., Dong, J. | | Deposition date: | 2023-09-24 |
|
| PDBID: | 8wi1 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-24 |
|
| PDBID: | 8ubs | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of NrdJ-1 split intein fusion | | Authors: | Kofoed, C., Ye, X., Jeffrey, P.D., Muir, T.W. | | Deposition date: | 2023-09-24 |
|
| PDBID: | 8ubq | | Status: | HPUB -- hold until publication | | Title: | EcDsbA soaked with N-(2-fluorophenyl)-5-methylisoxazole-3-carboxamide and 2-benzyl-4-phenylthiazole-5-carboxylic acid | | Authors: | Wang, G., Heras, B. | | Deposition date: | 2023-09-24 | | Sequence: | >Entity 1
AQYEDGKQYTTLEKPVAGAPQVLEFFSFFCPHCYQFEEVLHISDNVKKKLPEGVKMTKYHVNFMGGDLGKDLTQAWAVAMALGVEDKVTVPLFEGVQKTQTIRSASDIRDVFINAGIKGEEYDAAWNSFVVKSLVAQQEKAAADVQLRGVPAMFVNGKYQLNPQGMDTSNMDVFVQQYADTVKYLSEKK
|
|
| PDBID: | 8ubt | | Status: | HPUB -- hold until publication | | Title: | Structure of SCF-FBXL17-BACH1BTB E3 ligase complex | | Authors: | Shi, H., Cao, S. | | Deposition date: | 2023-09-24 |
|
| PDBID: | 8wia | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of E. coli ThrS catalytic domain mutant G463S | | Authors: | Qiao, H., Wang, Z., Wang, J., Fang, P. | | Deposition date: | 2023-09-24 |
|
| PDBID: | 8wig | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of E. coli ThrS catalytic domain mutant G463S/Q484A | | Authors: | Qiao, H., Wang, Z., Wang, J., Fang, P. | | Deposition date: | 2023-09-24 |
|
| PDBID: | 8wih | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of E. coli ThrS catalytic domain mutant G463A in complex with ATP | | Authors: | Qiao, H., Wang, Z., Wang, J., Fang, P. | | Deposition date: | 2023-09-24 |
|
| PDBID: | 8wii | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of E. coli ThrS catalytic domain mutant G463A in complex with Obafluorin | | Authors: | Qiao, H., Wang, Z., Wang, J., Fang, P. | | Deposition date: | 2023-09-24 |
|
| PDBID: | 8wij | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of E. coli ThrS catalytic domain mutant L489M in complex with Obafluorin | | Authors: | Qiao, H., Wang, Z., Wang, J., Fang, P. | | Deposition date: | 2023-09-24 |
|
| PDBID: | 8wie | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-24 |
|
| PDBID: | 8wjg | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-25 |
|
