| PDBID: | 8won | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of the 10-subunits Mmp1 complex from Mycobacterium smegmatis | | Authors: | Zhang, M., Tang, Y., Gao, Y., Liu, X., Lan, W., Liu, Y., Ma, M. | | Deposition date: | 2023-10-07 |
|
| PDBID: | 8woe | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-07 |
|
| PDBID: | 8wod | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of SIR2/HerA complex | | Authors: | Yu, G., Liao, F., Li, X., Li, Z., Zhang, H. | | Deposition date: | 2023-10-07 |
|
| PDBID: | 8wof | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-07 |
|
| PDBID: | 8wog | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of SUCR1 in complex with succinate and Gi protein | | Authors: | Liu, A., Ye, R.D. | | Deposition date: | 2023-10-07 |
|
| PDBID: | 8woh | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-07 |
|
| PDBID: | 8wp2 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-08 |
|
| PDBID: | 8uhc | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-08 |
|
| PDBID: | 8wp1 | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of SUCR1 in complex with cis-epoxysuccinic acid and Gi proteins | | Authors: | Liu, A., Ye, R.D. | | Deposition date: | 2023-10-08 |
|
| PDBID: | 8wpc | | Status: | HPUB -- hold until publication | | Title: | Complex structure of AtHPPD with LB553 | | Authors: | Yang, G.-F., Lin, H.-Y., Dong, J. | | Deposition date: | 2023-10-09 |
|
| PDBID: | 8wp7 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-09 |
|
| PDBID: | 8wpa | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-09 |
|
| PDBID: | 8qrp | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-09 |
|
| PDBID: | 8qrs | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-09 |
|
| PDBID: | 8qru | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-09 |
|
| PDBID: | 8qrv | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-09 |
|
| PDBID: | 8qrw | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2023-10-09 |
|
| PDBID: | 8qrj | | Status: | HPUB -- hold until publication | | Title: | LCC-ICCG PETase mutant H218Y | | Authors: | Orr, G., Niv, Y., Barakat, M., Boginya, A., Dessau, M., Afriat-Jurnou, L. | | Deposition date: | 2023-10-09 | | Sequence: | >Entity 1
MDGVLWRVRTAALMAALLALAAWALVWASPSVEAQSNPYQRGPNPTRSALTADGPFSVATYTVSRLSVSGFGGGVIYYPTGTSLTFGGIAMSPGYTADASSLAWLGRRLASHGFVVLVINTNSRFDGPDSRASQLSAALNYLRTSSPSAVRARLDANRLAVAGHSMGGGGTLRIAEQNPSLKAAVPLTPWHTDKTFNTSVPVLIVGAEADTVAPVSQYAIPFYQNLPSTTPKVYVELCNASHIAPNSNNAAISVYTISWMKLWVDNDTRYRQFLCNVNDPALCDFRTNNRHCQ
|
|
| PDBID: | 8qrz | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-09 |
|
| PDBID: | 8qrq | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-09 |
|
| PDBID: | 8qrr | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-09 |
|
| PDBID: | 8qro | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-09 |
|
| PDBID: | 8uht | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-09 |
|
| PDBID: | 8uhs | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-09 |
|
| PDBID: | 8uhp | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Deposition date: | 2023-10-09 |
|
