| PDBID: | 8r31 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-08 |
|
| PDBID: | 8r2z | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-08 |
|
| PDBID: | 8r3e | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-08 |
|
| PDBID: | 8r38 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-08 |
|
| PDBID: | 8r39 | | Status: | HPUB -- hold until publication | | Title: | Full-length LpMIP mutant Y16F | | Authors: | Whittaker, J.J., Guskov, A. | | Deposition date: | 2023-11-08 |
|
| PDBID: | 8uwz | | Status: | HPUB -- hold until publication | | Title: | The structure of Raamsizumab in complex with VEGF121 | | Authors: | Singer, A.U., Bruce, H., Blazer, L., Sicheri, F., Adams, J.J., Sidhu, S.S. | | Deposition date: | 2023-11-08 |
|
| PDBID: | 8ux6 | | Status: | HPUB -- hold until publication | | Title: | Structure of Fab B11 with a T. parva sporozoite neutralizing B cell epitope of p67 | | Authors: | Singer, A.U., Gopalsamy, A., Fellouse, F.A., Miersch, S., Sidhu, S.S. | | Deposition date: | 2023-11-08 |
|
| PDBID: | 8uwt | | Status: | HPUB -- hold until publication | | Title: | A X-ray Crystallographic Structure Model of a Glycoside Hydrolase (GH) Family 39 (GH39)-like Enzyme Encoded within a Xylan Utilization Locus of the pSOL1 Megaplasmid of Clostridium acetobutylicum | | Authors: | St John, F.J., Fujimoto, Z. | | Deposition date: | 2023-11-08 | | Sequence: | >Entity 1
MATTLTVDCRATLRGVTHCASGSLYGVTESKPFDINQFVAPLKPNVFTNPALAGFNHQQPIGAAIPTAGRLKNTTGKVMIRLADIFPRWPYGFTNMNDWLGKVTSVINQKKASGYSNFYGYEIWNEPDGTFKNNNVSFNDMWLQTYKLIRRLDPNSQIIGPSYSYYNHYNMNAFLNFCRANNCLPDVICWHELGGSQNISGNIRDLKTLERSLGIPERKIAINEYSDSNHYAEGQPGASAPFIAKFERNKVDSACISWWWTNAPGRLGSLMASDTQKGAGWWFYKWYGDMTGNMVNVIPQNDNSNLADGFACVDSNAKYISVLLGGVNDGTVNVNIKNIPAFIGSSATVKVEKVDWNGKDTPVNGTNTVFSKRYTVSNGTINVSIPGTNNTSGYRVYVSRLEHHHHHH
|
|
| PDBID: | 8ux4 | | Status: | HPUB -- hold until publication | | Title: | Mitochondrial ribosome of saccharomyces cerevisiae class II from YEP with Dextrose culture | | Authors: | Yu, Z., Zheng, F., Zhou, C. | | Deposition date: | 2023-11-08 |
|
| PDBID: | 8ux0 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-08 |
|
| PDBID: | 8ux3 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2023-11-08 |
|
| PDBID: | 8x1j | | Status: | HPUB -- hold until publication | | Title: | Study on the Mechanism of Dye Decolorizing Peroxidase Degradation of PVC | | Authors: | Zhang, Z., Yanng, D. | | Deposition date: | 2023-11-08 | | Sequence: | >Entity 1
MSQVQSGILPEHCRAAIWIEANVKGDVNALREASKNFVDNVATFQAKFPDAKLGAVVAFGNNVWRQLSGGEGAEELKDFPVYGKGLAPSTQYDLLIHILSARHEVNFSVAQAAMAAFGDAIDVKEEIHGFRWVEERDLSGFVDGTENPAGEETRREVAVIKDGVDAGGSYVFVQRWEHNLKQLNRMSVPDQEMMIGRTKEANEEIDGDERPVTSHLSRVDLKEDGKGLKIVRQSLPYGTASGTHGLYFCAYCARLYNIEQQLLSMFGDTDGKRDAMLRFTKPVTGGYYFAPSLERIQAL
>Entity 2
SQVQSGILPEHCRAAIWIEANVKGDVNALREASKNFVDNVATFQAKFPDAKLGAVVAFGNNVWRQLSGGEGAEELKDFPVYGKGLAPSTQYDLLIHILSARHEVNFSVAQAAMAAFGDAIDVKEEIHGFRPAGEETRREVAVIKDGVDAGGSYVFVQRWEHNLKQLKIVRQSLPYGTASGTHGLYFCAYCARLYNIEQQLLSMFMLRFTKPVTGGYYFAPSLERIQAL
|
|
| PDBID: | 8x1o | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-08 |
|
| PDBID: | 8x1u | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-08 |
|
| PDBID: | 8x1t | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-08 |
|
| PDBID: | 8x1m | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-08 |
|
| PDBID: | 8x1k | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-08 |
|
| PDBID: | 8x1s | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-08 |
|
| PDBID: | 8x1l | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-08 |
|
| PDBID: | 8x1r | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-08 |
|
| PDBID: | 8x1p | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-08 |
|
| PDBID: | 8x1q | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-08 |
|
| PDBID: | 8r3i | | Status: | HPUB -- hold until publication | | Title: | Proof of concept study of a probe molecule in TbPTR1 | | Authors: | Dawson, A., GIlbert, I.H., Montagna, S. | | Deposition date: | 2023-11-09 |
|
| PDBID: | 8r3m | | Status: | HPUB -- hold until publication | | Title: | Mycobacterium smegnatis RNA polymerase transcription initiation complex with SigmaA, RbpA, HelD N-terminal, CO and PCh loop domain, and an upstream-fork promoter fragment; State III conformation | | Authors: | Koval, T., Krasny, L., Dohnalek, J., Kouba, T. | | Deposition date: | 2023-11-09 |
|
| PDBID: | 8r3h | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Phalloidin bound F-actin | | Authors: | Yuan, B., Paraschiakos, T., Windhorst, S., Marlovits, T.C. | | Deposition date: | 2023-11-09 | | Release date: | 2025-05-09 |
|
