| PDBID: | 8wbi | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-09 |
|
| PDBID: | 8wbz | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2023-09-10 |
|
| PDBID: | 8wbw | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-10 |
|
| PDBID: | 8qht | | Status: | HPUB -- hold until publication | | Title: | Leishmania braziliensis PRMT1-PRMT3 heterotetrameric complex in unliganded form. | | Authors: | Levdikov, V., Nay, E., Walrad, P., Plevin, J.M. | | Deposition date: | 2023-09-10 | | Sequence: | >Entity 1
DYYFDSYSHYGIHMEMLKDYHRTTTYRDAIWRNAYMFKDKVVLDVGCGTGILSMFAARAGARKVIGIDCSNVAVQARQIVQDNGFSDIITIIQGKVEELDLDEKVDIIISEWMGYFLLYESMLNTVLYARDRWGASDVKILPSSANMYACGITDPQYVEQKFNIWNSVNGLDFSYFKRLSYIEPLIDTVNPEQIITDIVPFFSFDINRVTEAELSFTSTFTLEAKQGDFVHAISVHFDTPFYAGHDPVVLNTSPMVPPTHWRQTVLYMFHPLIMKRGEKANFTMKCAPNPGNPRDLDISLHIDFDGELQACHYDQDFRLR
>Entity 2
SAARISSNISTIHDHQRLRAYEVIFRNVRGKTLLHLGCGMGLYSMLAARGMAKMVIGIDSSAIVDAARVVAEQNGLKNIQFIRGRLCEALHQLPSDMKFDYVLCEWMGPLLLNERVLTDALYARDHLLTESGALCPNRASLHVVAVSDYAFRLDTEDFWSNVYGFQMEPMKELVRQEVEMCAIPGSNIVSAPCLAHTIHMDTLEGLTAEETATYEAQANQAAAIRDNEEENPVEHCWVPAAVAQKGYEAAFTLSIARSATVHYLTFYLDAAFTSKTNPGANFVLAVRPGGQNNWTEVSVGLREPLPVNAGEKIQGTVRVYTPAEKGGKVTVVEVTAKTAGQVAAIETFGTYYYQSY
|
|
| PDBID: | 8qhu | | Status: | HPUB -- hold until publication | | Title: | CRYO-EM STRUCTURE OF LEISHMANIA MAJOR 80S RIBOSOME : LM32Cs1C1 snoRNA overexpression | | Authors: | Rajan, K.S., Yonath, A., Bashan, A. | | Deposition date: | 2023-09-10 |
|
| PDBID: | 8u4h | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-10 |
|
| PDBID: | 8u4g | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-10 |
|
| PDBID: | 8u4m | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-10 |
|
| PDBID: | 8wby | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-10 |
|
| PDBID: | 8wc1 | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-09-11 | | Release date: | 2024-09-11 |
|
| PDBID: | 8qi9 | | Status: | HPUB -- hold until publication | | Title: | CrPhotLOV1 dark state structure determined by serial synchrotron crystallography at room temperature | | Authors: | Gotthard, G., Mous, S., Weinert, T., Maia, R.N.A., James, D., Dworkowski, F., Gashi, D., Antonia, F., Wang, M., Panepucci, E., Ozerov, D., Schertler, G.F.X., Heberle, J., Standfuss, J., Nogly, P. | | Deposition date: | 2023-09-11 |
|
| PDBID: | 8qib | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-11 |
|
| PDBID: | 8qhv | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-11 |
|
| PDBID: | 8qhw | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-11 |
|
| PDBID: | 8qhx | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-11 |
|
| PDBID: | 8qhz | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-11 |
|
| PDBID: | 8qi0 | | Status: | HPUB -- hold until publication | | Title: | 340A Vipp1 H1-6 helical tubes | | Authors: | Junglas, B., Sachse, C. | | Deposition date: | 2023-09-11 |
|
| PDBID: | 8qi1 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-11 |
|
| PDBID: | 8qi2 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-11 |
|
| PDBID: | 8qi3 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-11 |
|
| PDBID: | 8qi4 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2023-09-11 |
|
| PDBID: | 8qi5 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-11 |
|
| PDBID: | 8qia | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-11 |
|
| PDBID: | 8qi8 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-11 |
|
| PDBID: | 8qhy | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-11 |
|
