PDBID: | 8qfr | Status: | HPUB -- hold until publication | Deposition date: | 2023-09-04 |
|
PDBID: | 8u1z | Status: | HOLD -- hold until a certain date | Deposition date: | 2023-09-04 | Release date: | 2024-09-04 |
|
PDBID: | 8u1y | Status: | HPUB -- hold until publication | Title: | E.coli DsbA in complex with N-(4-(thiophen-3-yl)benzyl)cyclohexanamine | Authors: | Wang, G., Heras, B. | Deposition date: | 2023-09-04 | Sequence: | >Entity 1 AQYEDGKQYTTLEKPVAGAPQVLEFFSFFCPHCYQFEEVLHISDNVKKKLPEGVKMTKYHVNFMGGDLGKDLTQAWAVAMALGVEDKVTVPLFEGVQKTQTIRSASDIRDVFINAGIKGEEYDAAWNSFVVKSLVAQQEKAAADVQLRGVPAMFVNGKYQLNPQGMDTSNMDVFVQQYADTVKYLSEKK
|
|
PDBID: | 8w8m | Status: | HPUB -- hold until publication | Deposition date: | 2023-09-04 |
|
PDBID: | 8w8x | Status: | HPUB -- hold until publication | Title: | Cryo-EM structure of beta-MSH-MC3R-Gs_Nb35 complex | Authors: | Chen, Q., Fu, J. | Deposition date: | 2023-09-04 |
|
PDBID: | 8w8y | Status: | HPUB -- hold until publication | Title: | Cryo-EM structure of gamma-MSH-MC3R-Gs_Nb35 complex | Authors: | Chen, Q., Fu, J. | Deposition date: | 2023-09-04 |
|
PDBID: | 8w8o | Status: | HPUB -- hold until publication | Deposition date: | 2023-09-04 |
|
PDBID: | 8w90 | Status: | HOLD -- hold until a certain date | Deposition date: | 2023-09-04 | Release date: | 2024-09-04 |
|
PDBID: | 8w91 | Status: | HPUB -- hold until publication | Title: | Azumapecten Farreri homopolymeric ferritin mutant - H2KE exposed to H2O2 for 3 min | Authors: | Zhang, T., Jiao, R. | Deposition date: | 2023-09-04 |
|
PDBID: | 8w8z | Status: | HPUB -- hold until publication | Title: | Escherichia coli ferritin mutant-M52H | Authors: | Zhao, G., Zeng, R. | Deposition date: | 2023-09-04 |
|
PDBID: | 8w92 | Status: | HPUB -- hold until publication | Title: | human H ferritin with 2 Fe(II)/subunit loading | Authors: | Zhang, T., Jiao, R. | Deposition date: | 2023-09-04 |
|
PDBID: | 8w94 | Status: | HPUB -- hold until publication | Title: | Azumapecten Farreri homopolymeric ferritin (ApF) mutant-H2KE exposed to H2O2 for 2 s | Authors: | Zhang, T., Jiao, R. | Deposition date: | 2023-09-04 |
|
PDBID: | 8w95 | Status: | HPUB -- hold until publication | Title: | Azumapecten Farreri homopolymeric ferritin (ApF) mutant-H2KE exposed to H2O2 for 20 s | Authors: | Zhang, T., Jiao, R. | Deposition date: | 2023-09-04 |
|
PDBID: | 8w8v | Status: | HPUB -- hold until publication | Deposition date: | 2023-09-04 |
|
PDBID: | 8w96 | Status: | HPUB -- hold until publication | Title: | SmChiA with diacetyl chitobiose | Authors: | Yoshiko, T., Akihiko, N. | Deposition date: | 2023-09-04 |
|
PDBID: | 8w97 | Status: | HPUB -- hold until publication | Title: | De novo design protein -PK16 | Authors: | Wang, S., Liu, Y. | Deposition date: | 2023-09-04 |
|
PDBID: | 8w8w | Status: | HPUB -- hold until publication | Title: | Cryo-EM structure of alpha-MSH-MC3R-Gs_Nb35 complex | Authors: | Chen, Q., Fu, J. | Deposition date: | 2023-09-04 |
|
PDBID: | 8qgf | Status: | HPUB -- hold until publication | Title: | CRYSTAL STRUCTURE OF AS-ISOLATED M148L MUTANT OF THREE-DOMAIN HEME-CU NITRITE REDUCTASE FROM RALSTONIA PICKETTII | Authors: | Petchyam, N., Antonyuk, S., Hasnain, S.S. | Deposition date: | 2023-09-05 |
|
PDBID: | 8qfu | Status: | HOLD -- hold until a certain date | Title: | Diels-Alderase AbyU mutant - Y76F | Authors: | Tiwari, K., Burton, N.M., Yang, S., Race, P.R. | Deposition date: | 2023-09-05 | Release date: | 2024-09-05 |
|
PDBID: | 8qg2 | Status: | HPUB -- hold until publication | Title: | Crystal structure of NAD kinase 1 from Listeria monocytogenes in complex with a di-adenosine derivative | Authors: | Gelin, M., Labesse, G., Lionne, C. | Deposition date: | 2023-09-05 |
|
PDBID: | 8qg3 | Status: | HPUB -- hold until publication | Title: | Crystal structure of NAD kinase 1 from Listeria monocytogenes in complex with a di-adenosine derivative | Authors: | Gelin, M., Labesse, G., Lionne, C. | Deposition date: | 2023-09-05 |
|
PDBID: | 8qg4 | Status: | HPUB -- hold until publication | Title: | Crystal structure of NAD kinase 1 from Listeria monocytogenes in complex with a di-adenosine derivative | Authors: | Gelin, M., Labesse, G., Lionne, C. | Deposition date: | 2023-09-05 |
|
PDBID: | 8qg5 | Status: | HPUB -- hold until publication | Title: | Crystal structure of NAD kinase 1 from Listeria monocytogenes in complex with a di-adenosine derivative | Authors: | Gelin, M., Labesse, G., Lionne, C. | Deposition date: | 2023-09-05 |
|
PDBID: | 8qg6 | Status: | HPUB -- hold until publication | Title: | Crystal structure of NAD kinase 1 from Listeria monocytogenes in complex with a di-adenosine derivative | Authors: | Gelin, M., Labesse, G., Lionne, C. | Deposition date: | 2023-09-05 |
|
PDBID: | 8qgs | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2023-09-05 |
|