| PDBID: | 8qfr | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-04 |
|
| PDBID: | 8u1z | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-09-04 | | Release date: | 2024-09-04 |
|
| PDBID: | 8u1y | | Status: | HPUB -- hold until publication | | Title: | E.coli DsbA in complex with N-(4-(thiophen-3-yl)benzyl)cyclohexanamine | | Authors: | Wang, G., Heras, B. | | Deposition date: | 2023-09-04 | | Sequence: | >Entity 1
AQYEDGKQYTTLEKPVAGAPQVLEFFSFFCPHCYQFEEVLHISDNVKKKLPEGVKMTKYHVNFMGGDLGKDLTQAWAVAMALGVEDKVTVPLFEGVQKTQTIRSASDIRDVFINAGIKGEEYDAAWNSFVVKSLVAQQEKAAADVQLRGVPAMFVNGKYQLNPQGMDTSNMDVFVQQYADTVKYLSEKK
|
|
| PDBID: | 8w8m | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-04 |
|
| PDBID: | 8w8x | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of beta-MSH-MC3R-Gs_Nb35 complex | | Authors: | Chen, Q., Fu, J. | | Deposition date: | 2023-09-04 |
|
| PDBID: | 8w8y | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of gamma-MSH-MC3R-Gs_Nb35 complex | | Authors: | Chen, Q., Fu, J. | | Deposition date: | 2023-09-04 |
|
| PDBID: | 8w8o | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-04 |
|
| PDBID: | 8w90 | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-09-04 | | Release date: | 2024-09-04 |
|
| PDBID: | 8w91 | | Status: | HPUB -- hold until publication | | Title: | Azumapecten Farreri homopolymeric ferritin mutant - H2KE exposed to H2O2 for 3 min | | Authors: | Zhang, T., Jiao, R. | | Deposition date: | 2023-09-04 |
|
| PDBID: | 8w8z | | Status: | HPUB -- hold until publication | | Title: | Escherichia coli ferritin mutant-M52H | | Authors: | Zhao, G., Zeng, R. | | Deposition date: | 2023-09-04 |
|
| PDBID: | 8w92 | | Status: | HPUB -- hold until publication | | Title: | human H ferritin with 2 Fe(II)/subunit loading | | Authors: | Zhang, T., Jiao, R. | | Deposition date: | 2023-09-04 |
|
| PDBID: | 8w94 | | Status: | HPUB -- hold until publication | | Title: | Azumapecten Farreri homopolymeric ferritin (ApF) mutant-H2KE exposed to H2O2 for 2 s | | Authors: | Zhang, T., Jiao, R. | | Deposition date: | 2023-09-04 |
|
| PDBID: | 8w95 | | Status: | HPUB -- hold until publication | | Title: | Azumapecten Farreri homopolymeric ferritin (ApF) mutant-H2KE exposed to H2O2 for 20 s | | Authors: | Zhang, T., Jiao, R. | | Deposition date: | 2023-09-04 |
|
| PDBID: | 8w8v | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-04 |
|
| PDBID: | 8w96 | | Status: | HPUB -- hold until publication | | Title: | SmChiA with diacetyl chitobiose | | Authors: | Yoshiko, T., Akihiko, N. | | Deposition date: | 2023-09-04 |
|
| PDBID: | 8w97 | | Status: | HPUB -- hold until publication | | Title: | De novo design protein -PK16 | | Authors: | Wang, S., Liu, Y. | | Deposition date: | 2023-09-04 |
|
| PDBID: | 8w8w | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of alpha-MSH-MC3R-Gs_Nb35 complex | | Authors: | Chen, Q., Fu, J. | | Deposition date: | 2023-09-04 |
|
| PDBID: | 8qgf | | Status: | HPUB -- hold until publication | | Title: | CRYSTAL STRUCTURE OF AS-ISOLATED M148L MUTANT OF THREE-DOMAIN HEME-CU NITRITE REDUCTASE FROM RALSTONIA PICKETTII | | Authors: | Petchyam, N., Antonyuk, S., Hasnain, S.S. | | Deposition date: | 2023-09-05 |
|
| PDBID: | 8qfu | | Status: | HOLD -- hold until a certain date | | Title: | Diels-Alderase AbyU mutant - Y76F | | Authors: | Tiwari, K., Burton, N.M., Yang, S., Race, P.R. | | Deposition date: | 2023-09-05 | | Release date: | 2024-09-05 |
|
| PDBID: | 8qg2 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of NAD kinase 1 from Listeria monocytogenes in complex with a di-adenosine derivative | | Authors: | Gelin, M., Labesse, G., Lionne, C. | | Deposition date: | 2023-09-05 |
|
| PDBID: | 8qg3 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of NAD kinase 1 from Listeria monocytogenes in complex with a di-adenosine derivative | | Authors: | Gelin, M., Labesse, G., Lionne, C. | | Deposition date: | 2023-09-05 |
|
| PDBID: | 8qg4 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of NAD kinase 1 from Listeria monocytogenes in complex with a di-adenosine derivative | | Authors: | Gelin, M., Labesse, G., Lionne, C. | | Deposition date: | 2023-09-05 |
|
| PDBID: | 8qg5 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of NAD kinase 1 from Listeria monocytogenes in complex with a di-adenosine derivative | | Authors: | Gelin, M., Labesse, G., Lionne, C. | | Deposition date: | 2023-09-05 |
|
| PDBID: | 8qg6 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of NAD kinase 1 from Listeria monocytogenes in complex with a di-adenosine derivative | | Authors: | Gelin, M., Labesse, G., Lionne, C. | | Deposition date: | 2023-09-05 |
|
| PDBID: | 8qgs | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2023-09-05 |
|
