| PDBID: | 8wsa | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-17 |
|
| PDBID: | 8wsr | | Status: | HPUB -- hold until publication | | Title: | the structure of BtSY1_RBD/hACE2 protein | | Authors: | Xu, Z.P., Sun, J.Q. | | Deposition date: | 2023-10-17 |
|
| PDBID: | 8wsx | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | The toxin-antitoxin complex Fic-1-AntF is a deAMPylase that regulates the activity of DNA gyrase | | Authors: | Chen, F.R., Guo, L.W., Lu, C.H., Jiang, W.J., Luo, Z.Q., Liu, J.F., Zhang, L.Q. | | Deposition date: | 2023-10-17 |
|
| PDBID: | 8wt0 | | Status: | HOLD -- hold until a certain date | | Title: | The toxin-antitoxin complex Fic-1-AntF is a deAMPylase that regulates the activity of DNA gyrase | | Authors: | Chen, F.R., Guo, L.W., Lu, C.H., Jiang, W.J., Luo, Z.Q., Liu, J.F., Zhang, L.Q. | | Deposition date: | 2023-10-17 | | Release date: | 2024-10-17 |
|
| PDBID: | 8wsf | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of Mycobacterium tuberculosis ATP synthase Fo state 3 | | Authors: | Zhang, Y., Lai, Y., Liu, F., Rao, Z., Gong, H. | | Deposition date: | 2023-10-17 |
|
| PDBID: | 8ws9 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Cryo-EM mini structure of Cas12-1 with 5 nt complementary heteroduplex | | Authors: | Kuo, Z., Xi, Z. | | Deposition date: | 2023-10-17 | | Release date: | 2024-10-17 |
|
| PDBID: | 8wsh | | Status: | HOLD -- hold until a certain date | | Title: | Crystal structure of SARS-Cov-2 main protease, pH=4.0 | | Authors: | Zhou, X.L., Jiang, H.H., Zhang, J., Li, J. | | Deposition date: | 2023-10-17 | | Release date: | 2024-10-17 |
|
| PDBID: | 8wsi | | Status: | HOLD -- hold until a certain date | | Title: | Crystal structure of SARS-Cov-2 main protease, pH=6.0 | | Authors: | Jiang, H.H., Zhou, X.L., Zhang, J., Li, J. | | Deposition date: | 2023-10-17 | | Release date: | 2024-10-17 |
|
| PDBID: | 8wsk | | Status: | HOLD -- hold until a certain date | | Title: | Crystal structure of SARS-Cov-2 main protease, pH=8.5 | | Authors: | Jiang, H.H., Zhou, X.L., Zhang, J., Li, J. | | Deposition date: | 2023-10-17 | | Release date: | 2024-10-17 |
|
| PDBID: | 8wsl | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2023-10-17 | | Release date: | 2024-10-17 |
|
| PDBID: | 8qvn | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of Cx26 from Gallus Gallus in bicarbonate buffer | | Authors: | Brotherton, D.H., Cameron, A.D. | | Deposition date: | 2023-10-18 | | Sequence: | >Entity 1
MDWGTLQAVLGGVNKHSTSIGKIWLTVLFIFRIMILVVAAERVWGDEQQDFVCNTLQPGCRNVCYDHFFPISHIRLWALQLIFVSTPALLVAMHVAYTRHERKRRFRSGDKINIEELKNEKIHIRGPLWWTYTCSIFFRIVFEAVFMYVFYYMYDGYQMPRLVKCDAWPCPNVVDCFVSRPTEKTTFTIFMLAVSGICMMLNLAELCYLVIKVCLKDSGKTTVLK
|
|
| PDBID: | 8qvr | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-10-18 | | Release date: | 2024-10-18 |
|
| PDBID: | 8qw3 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-18 |
|
| PDBID: | 8qvz | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-18 |
|
| PDBID: | 8qw0 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-18 |
|
| PDBID: | 8qw1 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-18 |
|
| PDBID: | 8qw2 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-18 |
|
| PDBID: | 8qvy | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-18 |
|
| PDBID: | 8qvt | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-18 |
|
| PDBID: | 8qvx | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-18 |
|
| PDBID: | 8qvq | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-10-18 | | Release date: | 2024-10-18 |
|
| PDBID: | 8umz | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-10-18 | | Release date: | 2024-10-18 |
|
| PDBID: | 8una | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of a RecBCD mutant with RecB nuclease domain deletion | | Authors: | Hao, L., Zhang, R., Lohman, T.M. | | Deposition date: | 2023-10-18 |
|
| PDBID: | 8unb | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of a RecBCD mutant with RecB nuclease domain deletion in complex with blunt-ended dsDNA | | Authors: | Hao, L., Zhang, R., Lohman, T.M. | | Deposition date: | 2023-10-18 |
|
| PDBID: | 8une | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-18 |
|
