| PDBID: | 9eum | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-27 |
|
| PDBID: | 9euf | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-27 |
|
| PDBID: | 8vz3 | | Status: | HPUB -- hold until publication | | Title: | Structure of human PIN1 covalently derivatized with SuFEx compound | | Authors: | Louie, G.V., Noel, J.P., Wang, W.-M., Kelly, J.W. | | Deposition date: | 2024-02-09 |
|
| PDBID: | 9euh | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-27 |
|
| PDBID: | 8wxs | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-30 |
|
| PDBID: | 9eui | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-27 |
|
| PDBID: | 8wci | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-12 |
|
| PDBID: | 9euj | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-27 |
|
| PDBID: | 8xsp | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-09 |
|
| PDBID: | 9euk | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-27 |
|
| PDBID: | 8y27 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-25 |
|
| PDBID: | 9eul | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-27 |
|
| PDBID: | 8xnl | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-30 |
|
| PDBID: | 9etx | | Status: | HPUB -- hold until publication | | Title: | KEAP1 BTB in complex with compound 23 | | Authors: | Richardson, W., Bullock, A.N., Rothweiler, E.M., Manning, C.E., Sweeney, M.N., Chalk, R., Huber, K.V.M. | | Deposition date: | 2024-03-27 |
|
| PDBID: | 8xbo | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-06 |
|
| PDBID: | 9ety | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-27 |
|
| PDBID: | 8x8j | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-27 |
|
| PDBID: | 9eu5 | | Status: | HOLD -- hold until a certain date | | Title: | SSX structure of Autotaxin at room temperature | | Authors: | Eymery, M.C., McCarthy, A.A., Foos, N., Basu, S. | | Deposition date: | 2024-03-27 | | Release date: | 2025-03-27 |
|
| PDBID: | 8xa4 | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-12-01 | | Release date: | 2024-12-01 |
|
| PDBID: | 9eu0 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-27 |
|
| PDBID: | 8x2b | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-09 |
|
| PDBID: | 9eu3 | | Status: | HPUB -- hold until publication | | Title: | GH29A alpha-L-fucosidase | | Authors: | Yang, Y.Y., Zeuner, B., Morth, J.P. | | Deposition date: | 2024-03-27 | | Sequence: | >Entity 1
MPAQPGYTPSADNLKARETFQDDKFGIFIHWGIYSMLADGEWVMHNKNLNWEEYAKLASGFYPAKFNAAEWVAAIKASGAKYITITSRHHDGFSMYATQQSDYNIVDATPFKRDVIHELADECRKQGIRLHLYYSHLDWRRDDYYPLGRTGKGTGRTTQGKWEDYCAFMNNQLTELLTNYGLIGAIWFDGMWDKDIYPDGMTAKTWNLNEQYTLIHRLQPACLIGNNHHITPFAGEDIQIFERDLPGENKAGLSGQDISRLPLETCETMNGMWGYKITDQDYKSTKILIQYLVKAAGKNANLLMNVGPQPNGELPTVAVQRLREMGEWMKIYAPTIQGTRGGVVTPRDWGVTTQKGKTLYVHVLNLDDKALFLPYAGNKLKSAVEYQSRKSVRFIQDRDGILLKFTDKPHSPDYVLELTFANELPLNLEHHHHHH
|
|
| PDBID: | 8x2f | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-09 |
|
| PDBID: | 9eu2 | | Status: | HPUB -- hold until publication | | Title: | GH29A alpha-L-fucosidase | | Authors: | Yang, Y.Y., Zeuner, B., Morth, J.P. | | Deposition date: | 2024-03-27 | | Sequence: | >Entity 1
MPAQPGYTPSADNLKARETFQDDKFGIFIHWGIYSMLADGEWVMHNKNLNWEEYAKLASGFYPAKFNAAEWVAAIKASGAKYITITSRHHDGFSMYATQQSDYNIVDATPFKRDVIHELADECRKQGIRLHLYYSHLDWRRDDYYPLGRTGKGTGRTTQGKWEDYCAFMNNQLTELLTNYGLIGAIWFDGMWDKDIYPDGMTAKTWNLNEQYTLIHRLQPACLIGNNHHITPFAGEDIQIFERDLPGENKAGLSGQDISRLPLETCETMNGMWGYKITDQDYKSTKILIQYLVKAAGKNANLLMNVGPQPNGELPTVAVQRLREMGEWMKIYAPTIQGTRGGVVTPRDWGVTTQKGKTLYVHVLNLDDKALFLPYAGNKLKSAVEYQSRKSVRFIQDRDGILLKFTDKPHSPDYVLELTFANELPLNLEHHHHHH
|
|
| PDBID: | 8x2e | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-09 |
|
