PDBID: | 8vzt | Status: | HPUB -- hold until publication | Deposition date: | 2024-02-12 |
|
PDBID: | 8vzv | Status: | HPUB -- hold until publication | Deposition date: | 2024-02-12 |
|
PDBID: | 8ybd | Status: | HPUB -- hold until publication | Deposition date: | 2024-02-13 |
|
PDBID: | 8s0a | Status: | HPUB -- hold until publication | Deposition date: | 2024-02-13 |
|
PDBID: | 8s09 | Status: | HPUB -- hold until publication | Title: | H. sapiens MCM2-7 double hexamer bound to double stranded DNA | Authors: | Greiwe, J.F., Weissmann, F., Diffley, J.F.X., Costa, A. | Deposition date: | 2024-02-13 |
|
PDBID: | 8s08 | Status: | HPUB -- hold until publication | Deposition date: | 2024-02-13 |
|
PDBID: | 8rzx | Status: | HPUB -- hold until publication | Deposition date: | 2024-02-13 |
|
PDBID: | 8s0e | Status: | HPUB -- hold until publication | Deposition date: | 2024-02-13 |
|
PDBID: | 8s0d | Status: | HPUB -- hold until publication | Title: | H. sapiens MCM bound to double stranded DNA and ORC1-6 | Authors: | Greiwe, J.F., Weissmann, F., Diffley, J.F.X., Costa, A. | Deposition date: | 2024-02-13 |
|
PDBID: | 8s02 | Status: | HPUB -- hold until publication | Deposition date: | 2024-02-13 |
|
PDBID: | 8s05 | Status: | WAIT -- processing started, waiting for author input to continue processing | Title: | ArnAB complex an archaeal ortholog of the Sec23/24 core motif | Authors: | Korf, L., Steinchen, W., Watad, M., Bezold, F., Vogt, M.S., Selbach, L., Penner, A., Tourte, M., Hepp, S., Albers, S.V., Essen, L.-O. | Deposition date: | 2024-02-13 |
|
PDBID: | 8rzz | Status: | HPUB -- hold until publication | Deposition date: | 2024-02-13 | Sequence: | >Entity 1 MDLAKLGLKEVMPTKINLEGLVGDHAFSMEGVGEGNILEGTQEVKISVTKGAPLPFAFDIVSVAF(CRO)NRAYTGYPEEISDYFLQSFPEGFTYERNIRYQDGGTAIVKSDISLEDGKFIVNVDFKAKDLRRMGPVMQQDIVGMQPSYESMYTNVTSVIGECIIAFKLQTGKHFTYHMRTVYKSKKPVETMPLYHFIQHRLVKTNVDTASGYVVQHETAIAAHSTIKKIEGSLP
>Entity 2 MTSKVYDPEQRKRMITGPQWWARCKQMNVLDSFINYYDSEKHAENAVIFLHGNATSSYLWRHVVPHIEPVARCIIPDLIGMGKSGKSGNGSYRLLDHYKYLTAWFELLNLPKKIIFVGHDWGAALAFHYAYEHQDRIKAIVHMESVVDVIESWDEWPDIEEDIALIKSEEGEKMVLENNFFVETVLPSKIMRKLEPEEFAAYLEPFKEKGEVRRPTLSWPREIPLVKGGKPDVVQIVRNYNAYLRASDDLPKLFIESDPGFFSNAIVEGAKKFPNTEFVKVKGLHFLQEDAPDEMGKYIKSFVERVLKNEQSGLEVLFQ
|
|
PDBID: | 8s0b | Status: | HPUB -- hold until publication | Deposition date: | 2024-02-13 |
|
PDBID: | 8s0c | Status: | HPUB -- hold until publication | Deposition date: | 2024-02-13 |
|
PDBID: | 8rzs | Status: | HPUB -- hold until publication | Deposition date: | 2024-02-13 |
|
PDBID: | 8rzt | Status: | HPUB -- hold until publication | Deposition date: | 2024-02-13 |
|
PDBID: | 8s0f | Status: | HPUB -- hold until publication | Deposition date: | 2024-02-13 |
|
PDBID: | 8rzu | Status: | HPUB -- hold until publication | Title: | Structure of human SETD2 L1609P mutant in complex with SAM and H3K36M peptide | Authors: | Mechaly, A.E., Michail, C., Haouz, A., Rodrigues-Lima, F. | Deposition date: | 2024-02-13 |
|
PDBID: | 8s00 | Status: | HPUB -- hold until publication | Title: | CpKRS complexed with lysine and an inhibitor | Authors: | Dawson, A., Baragana, B., Caldwell, N. | Deposition date: | 2024-02-13 |
|
PDBID: | 8w05 | Status: | HPUB -- hold until publication | Title: | Crystal Structure of the reconstruction of the ancestral triosephosphate isomerase of the last opisthokont common ancestor obtained by maximum likelihood | Authors: | Perez-Nino, J.A., Rodriguez-Romero, A., Guerra-Borrego, Y., Fernandez-Velasco, D.A. | Deposition date: | 2024-02-13 |
|
PDBID: | 8w06 | Status: | HPUB -- hold until publication | Title: | Crystal Structure of the reconstruction of the ancestral triosephosphate isomerase of the last opisthokont common ancestor obtained by maximum likelihood with PGH | Authors: | Perez-Nino, J.A., Rodriguez-Romero, A., Guerra-Borrego, Y., Fernandez-Velasco, D.A. | Deposition date: | 2024-02-13 |
|
PDBID: | 8w0e | Status: | HPUB -- hold until publication | Deposition date: | 2024-02-13 |
|
PDBID: | 8w0f | Status: | HPUB -- hold until publication | Deposition date: | 2024-02-13 |
|
PDBID: | 8w0g | Status: | HPUB -- hold until publication | Deposition date: | 2024-02-13 |
|
PDBID: | 8w0i | Status: | HPUB -- hold until publication | Deposition date: | 2024-02-13 |
|