| PDBID: | 8viv | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of FBF-2 RBD in complex with gld-1 FBEa* RNA | | Authors: | Qiu, C., Hall, T.M.T. | | Deposition date: | 2024-01-05 |
|
| PDBID: | 8viy | | Status: | HPUB -- hold until publication | | Title: | 15-Lipoxygenase-2 V427L | | Authors: | Gilbert, N.C., Offenbacher, A.R., Ohler, A.R.L. | | Deposition date: | 2024-01-05 |
|
| PDBID: | 8vio | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-05 |
|
| PDBID: | 8vip | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-05 |
|
| PDBID: | 8viq | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-05 |
|
| PDBID: | 8vir | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-05 |
|
| PDBID: | 8vit | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the N-terminal domain of fatty acid kinase A (FakA) from Staphylococcus aureus (Mg and ADP) | | Authors: | Lovell, S., Kashipathy, M.M., Battaile, K.P., Bose, J.L. | | Deposition date: | 2024-01-05 |
|
| PDBID: | 8viz | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-05 |
|
| PDBID: | 8vj0 | | Status: | HPUB -- hold until publication | | Title: | Neutron Structure of Oxidized Trp161Phe MnSOD | | Authors: | Azadmanesh, J., Slobodnik, K., Struble, L.R., Lutz, W.E., Weiss, K.L., Myles, D.A.A., Kroll, T., Borgstahl, G.E.O. | | Deposition date: | 2024-01-05 | | Sequence: | >Entity 1
MKHSLPDLPYDYGALEPHINAQIMQLHHSKHHAAYVNNLNVTEEKYQEALAKGDVTAQIALQPALKFNGGGHINHSIFWTNLSPNGGGEPKGELLEAIKRDFGSFDKFKEKLTAASVGVQGSGWGWLGFNKERGHLQIAACPNQDPLQGTTGLIPLLGIDVFEHAYYLQYKNVRPDYLKAIWNVINWENVTERYMACKK
|
|
| PDBID: | 8vj1 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-05 |
|
| PDBID: | 8vj4 | | Status: | HPUB -- hold until publication | | Title: | X-ray Counterpart to the Neutron Structure of Peroxide-Soaked Trp161Phe MnSOD | | Authors: | Azadmanesh, J., Slobodnik, K., Struble, L.R., Lutz, W.E., Weiss, K.L., Myles, D.A.A., Kroll, T., Borgstahl, G.E.O. | | Deposition date: | 2024-01-05 | | Sequence: | >Entity 1
MKHSLPDLPYDYGALEPHINAQIMQLHHSKHHAAYVNNLNVTEEKYQEALAKGDVTAQIALQPALKFNGGGHINHSIFWTNLSPNGGGEPKGELLEAIKRDFGSFDKFKEKLTAASVGVQGSGWGWLGFNKERGHLQIAACPNQDPLQGTTGLIPLLGIDVFEHAYYLQYKNVRPDYLKAIWNVINWENVTERYMACKK
|
|
| PDBID: | 8vj8 | | Status: | HPUB -- hold until publication | | Title: | X-ray Counterpart to Neutron Structure of Reduced Trp161Phe MnSOD | | Authors: | Azadmanesh, J., Slobodnik, K., Struble, L.R., Lutz, W.E., Weiss, K.L., Myles, D.A.A., Kroll, T., Borgstahl, G.E.O. | | Deposition date: | 2024-01-05 | | Sequence: | >Entity 1
MKHSLPDLPYDYGALEPHINAQIMQLHHSKHHAAYVNNLNVTEEKYQEALAKGDVTAQIALQPALKFNGGGHINHSIFWTNLSPNGGGEPKGELLEAIKRDFGSFDKFKEKLTAASVGVQGSGWGWLGFNKERGHLQIAACPNQDPLQGTTGLIPLLGIDVFEHAYYLQYKNVRPDYLKAIWNVINWENVTERYMACKK
|
|
| PDBID: | 8viu | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-05 |
|
| PDBID: | 8vj5 | | Status: | HPUB -- hold until publication | | Title: | Peroxide-Soaked MnSOD | | Authors: | Azadmanesh, J., Slobodnik, K., Struble, L.R., Lutz, W.E., Weiss, K.L., Myles, D.A.A., Kroll, T., Borgstahl, G.E.O. | | Deposition date: | 2024-01-05 | | Sequence: | >Entity 1
MKHSLPDLPYDYGALEPHINAQIMQLHHSKHHAAYVNNLNVTEEKYQEALAKGDVTAQIALQPALKFNGGGHINHSIFWTNLSPNGGGEPKGELLEAIKRDFGSFDKFKEKLTAASVGVQGSGWGWLGFNKERGHLQIAACPNQDPLQGTTGLIPLLGIDVWEHAYYLQYKNVRPDYLKAIWNVINWENVTERYMACKK
|
|
| PDBID: | 8xr7 | | Status: | HPUB -- hold until publication | | Title: | Dual receptor-binding, infectivity, and transmissibility of an emerging H2N2 avian influenza virus | | Authors: | Sun, J., Zheng, T.Y. | | Deposition date: | 2024-01-06 |
|
| PDBID: | 8xr8 | | Status: | HPUB -- hold until publication | | Title: | Dual receptor-binding, infectivity, and transmissibility of an emerging H2N2 avian influenza virus | | Authors: | Sun, J., Zheng, T.Y. | | Deposition date: | 2024-01-06 |
|
| PDBID: | 8xrc | | Status: | HPUB -- hold until publication | | Title: | Dual receptor-binding, infectivity, and transmissibility of an emerging H2N2 avian influenza virus | | Authors: | Sun, J., Zheng, T.Y. | | Deposition date: | 2024-01-06 |
|
| PDBID: | 8xrd | | Status: | HPUB -- hold until publication | | Title: | Dual receptor-binding, infectivity, and transmissibility of an emerging H2N2 avian influenza virus | | Authors: | Sun, J., Zheng, T.Y. | | Deposition date: | 2024-01-06 |
|
| PDBID: | 8xrb | | Status: | HPUB -- hold until publication | | Title: | Dual receptor-binding, infectivity, and transmissibility of an emerging H2N2 avian influenza virus | | Authors: | Sun, J., Zheng, T.Y. | | Deposition date: | 2024-01-06 |
|
| PDBID: | 8xra | | Status: | HPUB -- hold until publication | | Title: | Dual receptor-binding, infectivity, and transmissibility of an emerging H2N2 avian influenza virus | | Authors: | Sun, J., Zheng, T.Y. | | Deposition date: | 2024-01-06 |
|
| PDBID: | 8xr9 | | Status: | HPUB -- hold until publication | | Title: | Dual receptor-binding, infectivity, and transmissibility of an emerging H2N2 avian influenza virus | | Authors: | Sun, J., Zheng, T.Y. | | Deposition date: | 2024-01-06 |
|
| PDBID: | 8xr5 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of PD-L1 complexed with small molecule inhibitor X18 | | Authors: | Liu, L. | | Deposition date: | 2024-01-06 |
|
| PDBID: | 8rmh | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of parallel G-quadruplex containing T-tetrads and TG-octaplet | | Authors: | Abdullrahman, A., El Omari, K., Paterson, N., Orr, C., Lambert, M., Cardin, C.J., Sanchez-Weatherby, J., Hall, J.P. | | Deposition date: | 2024-01-06 |
|
| PDBID: | 8rmi | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of ferrioxamine transporter FoxA | | Authors: | Josts, I., Tidow, H., Mislin, G. | | Deposition date: | 2024-01-06 |
|
| PDBID: | 8vjg | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Deposition date: | 2024-01-06 |
|
