PDBID: | 8vhu | Status: | HPUB -- hold until publication | Deposition date: | 2024-01-02 |
|
PDBID: | 8vhq | Status: | HPUB -- hold until publication | Deposition date: | 2024-01-02 |
|
PDBID: | 8vhr | Status: | HPUB -- hold until publication | Deposition date: | 2024-01-02 |
|
PDBID: | 8vht | Status: | HPUB -- hold until publication | Title: | Cryo EM structure of a soybean CesA3 homotrimer | Authors: | Ho, R., Palliniti, P., Zimmer, J. | Deposition date: | 2024-01-02 |
|
PDBID: | 8vhx | Status: | HOLD -- hold until a certain date | Title: | Cryo-EM of neck of bacteriophage Chi | Authors: | Sonani, R.R., Esteves, N.C., Scharf, B.E., Egelman, E.H. | Deposition date: | 2024-01-02 | Release date: | 2025-01-02 |
|
PDBID: | 8vhw | Status: | HPUB -- hold until publication | Title: | Neutron Structure of Peroxide-Soaked Trp161Phe MnSOD | Authors: | Azadmanesh, J., Slobodnik, K., Struble, L.R., Lutz, W.E., Coates, L., Weiss, K.L., Myles, D.A.A., Kroll, T., Borgstahl, G.E.O. | Deposition date: | 2024-01-02 | Sequence: | >Entity 1 MKHSLPDLPYDYGALEPHINAQIMQLHHSKHHAAYVNNLNVTEEKYQEALAKGDVTAQIALQPALKFNGGGHINHSIFWTNLSPNGGGEPKGELLEAIKRDFGSFDKFKEKLTAASVGVQGSGWGWLGFNKERGHLQIAACPNQDPLQGTTGLIPLLGIDVFEHAYYLQYKNVRPDYLKAIWNVINWENVTERYMACKK
|
|
PDBID: | 8vhz | Status: | HPUB -- hold until publication | Title: | Cryo EM structure of a soybean CesA1 homotrimer | Authors: | Ho, R., Palliniti, P., Zimmer, J. | Deposition date: | 2024-01-02 |
|
PDBID: | 8vi0 | Status: | HPUB -- hold until publication | Title: | Cryo EM structure of a soybean CesA6 homotrimer | Authors: | Ho, R., Palliniti, P., Zimmer, J. | Deposition date: | 2024-01-02 |
|
PDBID: | 8vhy | Status: | HPUB -- hold until publication | Title: | Neutron Structure of Reduced Trp161Phe MnSOD | Authors: | Azadmanesh, J., Slobodnik, K., Struble, L.R., Lutz, W.E., Coates, L., Weiss, K.L., Myles, D.A.A., Kroll, T., Borgstahl, G.E.O. | Deposition date: | 2024-01-02 | Sequence: | >Entity 1 MKHSLPDLPYDYGALEPHINAQIMQLHHSKHHAAYVNNLNVTEEKYQEALAKGDVTAQIALQPALKFNGGGHINHSIFWTNLSPNGGGEPKGELLEAIKRDFGSFDKFKEKLTAASVGVQGSGWGWLGFNKERGHLQIAACPNQDPLQGTTGLIPLLGIDVFEHAYYLQYKNVRPDYLKAIWNVINWENVTERYMACKK
|
|
PDBID: | 8vhv | Status: | HPUB -- hold until publication | Deposition date: | 2024-01-02 |
|
PDBID: | 8xph | Status: | HPUB -- hold until publication | Title: | Marine Planctomycetes laminarinase PtLam | Authors: | Yang, J. | Deposition date: | 2024-01-03 |
|
PDBID: | 8xp4 | Status: | HPUB -- hold until publication | Deposition date: | 2024-01-03 |
|
PDBID: | 8xp6 | Status: | HPUB -- hold until publication | Title: | 2OG-Fe(II) oxygenase-ColD | Authors: | Zhang, B., Shi, J., Zhang, Y., Ge, H.M. | Deposition date: | 2024-01-03 |
|
PDBID: | 8xp7 | Status: | HPUB -- hold until publication | Deposition date: | 2024-01-03 |
|
PDBID: | 8xpf | Status: | HPUB -- hold until publication | Title: | 2OG-Fe(II) oxygenase-ColD in complex with collinodins | Authors: | Zhang, B., Shi, J., Zhang, Y., Ge, H.M. | Deposition date: | 2024-01-03 |
|
PDBID: | 8xpj | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2024-01-03 |
|
PDBID: | 8xpk | Status: | HPUB -- hold until publication | Title: | Marine bacterial laminarinase PtLam mutant E154A in complex with laminatriose | Authors: | Yang, J. | Deposition date: | 2024-01-03 |
|
PDBID: | 8xpi | Status: | HOLD -- hold until a certain date | Deposition date: | 2024-01-03 | Release date: | 2025-01-03 |
|
PDBID: | 8xpl | Status: | HPUB -- hold until publication | Deposition date: | 2024-01-03 |
|
PDBID: | 8rlt | Status: | HPUB -- hold until publication | Deposition date: | 2024-01-03 |
|
PDBID: | 8rlv | Status: | HPUB -- hold until publication | Deposition date: | 2024-01-03 |
|
PDBID: | 8rlu | Status: | HPUB -- hold until publication | Deposition date: | 2024-01-03 |
|
PDBID: | 8rli | Status: | HPUB -- hold until publication | Deposition date: | 2024-01-03 |
|
PDBID: | 8rlf | Status: | HPUB -- hold until publication | Deposition date: | 2024-01-03 |
|
PDBID: | 8rlh | Status: | HPUB -- hold until publication | Deposition date: | 2024-01-03 |
|