PDBID: | 8xgl | Status: | HPUB -- hold until publication | Deposition date: | 2023-12-15 |
|
PDBID: | 8xgp | Status: | HPUB -- hold until publication | Deposition date: | 2023-12-15 |
|
PDBID: | 8rhd | Status: | HPUB -- hold until publication | Title: | Crystal structure of Neisseria gonorrhoeae FabI in complex with NADH and (E)-3-((2R,3S)-3-hydroxy-2-methyl-4-oxo-2,3,4,5-tetrahydro-1H-pyrido[2,3-b][1,4]diazepin-8-yl)-N-methyl-N-((3-methylbenzofuran-2-yl)methyl)acrylamide | Authors: | Ronin, C., Gerusz, V., Ciesielski, F. | Deposition date: | 2023-12-15 |
|
PDBID: | 8rhm | Status: | HPUB -- hold until publication | Deposition date: | 2023-12-15 | Sequence: | >Entity 1 GPGSRTPVELRLTEIFRDVLGHDAFGVLDDFFELGGDSFKAIRIAAKYGPPLEVTDIYDHPTIEALAAHLAR
|
|
PDBID: | 8rh7 | Status: | HPUB -- hold until publication | Deposition date: | 2023-12-15 |
|
PDBID: | 8rh8 | Status: | HPUB -- hold until publication | Deposition date: | 2023-12-15 |
|
PDBID: | 8rha | Status: | HPUB -- hold until publication | Deposition date: | 2023-12-15 |
|
PDBID: | 8rh9 | Status: | HPUB -- hold until publication | Deposition date: | 2023-12-15 |
|
PDBID: | 8rhg | Status: | HPUB -- hold until publication | Deposition date: | 2023-12-15 |
|
PDBID: | 8rhh | Status: | REPL -- author sent new coordinates, entry to be reprocessed | Deposition date: | 2023-12-15 |
|
PDBID: | 8rho | Status: | HPUB -- hold until publication | Deposition date: | 2023-12-15 |
|
PDBID: | 8rhp | Status: | HPUB -- hold until publication | Deposition date: | 2023-12-15 |
|
PDBID: | 8rhb | Status: | REPL -- author sent new coordinates, entry to be reprocessed | Deposition date: | 2023-12-15 |
|
PDBID: | 8vdj | Status: | HPUB -- hold until publication | Deposition date: | 2023-12-15 |
|
PDBID: | 8vdh | Status: | HPUB -- hold until publication | Deposition date: | 2023-12-15 |
|
PDBID: | 8vdl | Status: | HPUB -- hold until publication | Title: | HB3VAR03 CIDRa1.4 domain with C7 Fab | Authors: | Hurlburt, N.K., Pancera, M. | Deposition date: | 2023-12-15 |
|
PDBID: | 8vdk | Status: | AUTH -- processed, waiting for author review and approval | Title: | Crystal Structure of LPXTG-motif Cell Wall Anchor Domain Protein MSCRAMM_SdrD from Staphylococcus aureus | Authors: | Kim, Y., Tan, A., Endres, M., Joachimiak, A., Center for Structural Biology of Infectious Diseases (CSBID) | Deposition date: | 2023-12-15 |
|
PDBID: | 8vdf | Status: | HPUB -- hold until publication | Title: | Cryo-EM structure of human monoclonal antibody C7 targeting IT4VAR22 CIDRa1.7 (PfEMP1 A) | Authors: | Raghavan, S.S.R., Ward, A.B. | Deposition date: | 2023-12-15 |
|
PDBID: | 8vdg | Status: | HPUB -- hold until publication | Title: | Cryo-EM structure of human monoclonal antibody C74 targeting IT4VAR22 CIDRa1.7 | Authors: | Raghavan, S.S.R., Ward, A.B. | Deposition date: | 2023-12-15 |
|
PDBID: | 8vdi | Status: | HPUB -- hold until publication | Deposition date: | 2023-12-15 |
|
PDBID: | 8xgz | Status: | HPUB -- hold until publication | Deposition date: | 2023-12-16 |
|
PDBID: | 8xh0 | Status: | HPUB -- hold until publication | Title: | Monoclinic crystal structure of green fluorescent protein nowGFP at pH 4.8 | Authors: | Kim, C.U., Kim, J.K. | Deposition date: | 2023-12-16 |
|
PDBID: | 8xh1 | Status: | HPUB -- hold until publication | Title: | Orthorhombic crystal structure of green fluorescent protein nowGFP at pH 9.0 | Authors: | Kim, C.U., Kim, J.K. | Deposition date: | 2023-12-16 |
|
PDBID: | 8xh2 | Status: | HPUB -- hold until publication | Title: | Orthorhombic crystal structure of green fluorescent protein nowGFP at pH 6.0 | Authors: | Kim, C.U., Kim, J.K. | Deposition date: | 2023-12-16 |
|
PDBID: | 8vdo | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2023-12-16 |
|