| PDBID: | 8ut0 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Eukaryotic 80S ribosome with Reh1, eIF5A and A/P site tRNA | | Authors: | Yelland, J.N., Taylor, D.W., Johnson, A.W. | | Deposition date: | 2023-10-30 |
|
| PDBID: | 8usz | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-30 |
|
| PDBID: | 8usv | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-30 |
|
| PDBID: | 8utd | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-30 |
|
| PDBID: | 8usy | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-30 |
|
| PDBID: | 8wxl | | Status: | HPUB -- hold until publication | | Title: | Structure of the SARS-CoV-2 BA.2.86 spike glycoprotein (closed state) | | Authors: | Yajima, H., Anraku, Y., Kita, S., Kimura, K., Maenaka, K., Hashiguchi, T. | | Deposition date: | 2023-10-30 |
|
| PDBID: | 8wxs | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-30 |
|
| PDBID: | 8wxw | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-30 |
|
| PDBID: | 8wxz | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-30 |
|
| PDBID: | 8wy2 | | Status: | HPUB -- hold until publication | | Title: | X-Ray crystal structure of glycoside hydrolase family 6 cellobiohydrolase from Phanerochaete chrysosporium PcCel6A S176V/C240S/C393S | | Authors: | Yamaguchi, S., Sunagawa, N., Tachioka, M., Igarashi, K. | | Deposition date: | 2023-10-30 |
|
| PDBID: | 8wyj | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | The global map of Omicron Subvariants Spike with two antibodies | | Authors: | Yan, R.H., Wang, A.J., Yang, H.N. | | Deposition date: | 2023-10-31 | | Release date: | 2024-10-31 |
|
| PDBID: | 8wyy | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-31 |
|
| PDBID: | 8wyx | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-31 |
|
| PDBID: | 8wym | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of Ryanodine receptor 1 (100 nM Ca2+, pre-open state) | | Authors: | Qiang, C., Hongli, H. | | Deposition date: | 2023-10-31 |
|
| PDBID: | 8wys | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-31 |
|
| PDBID: | 8r0n | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-31 |
|
| PDBID: | 8r0o | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-31 |
|
| PDBID: | 8r0k | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-31 |
|
| PDBID: | 8r0m | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-31 |
|
| PDBID: | 8r0p | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-31 |
|
| PDBID: | 8r0t | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-10-31 | | Release date: | 2024-10-31 |
|
| PDBID: | 8r0c | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-31 |
|
| PDBID: | 8r0d | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of Borneoldehydrogenase ancestor N39 | | Authors: | Helmer, C.P.O., Dimos, N., Loll, B. | | Deposition date: | 2023-10-31 |
|
| PDBID: | 8r0h | | Status: | HPUB -- hold until publication | | Title: | Pim1 in complex with (E)-3-(2-(thiophen-2-yl)vinyl)-3,4-dihydroquinoxalin-2(1H)-one and Pimtide | | Authors: | Hochban, P.M.M., Heine, A., Diederich, W.E. | | Deposition date: | 2023-10-31 | | Sequence: | >Entity 1
SMLLSKINSLAHLRAAPCNDLHATKLAPGKEKEPLESQYQVGPLLGSGGFGSVYSGIRVSDNLPVAIKHVEKDRISDWGELPNGTRVPMEVVLLKKVSSGFSGVIRLLDWFERPDSFVLILERPEPVQDLFDFITERGALQEELARSFFWQVLEAVRHCHNCGVLHRDIKDENILIDLNRGELKLIDFGSGALLKDTVYTDFDGTRVYSPPEWIRYHRYHGRSAAVWSLGILLYDMVCGDIPFEHDEEIIGGQVFFRQRVS(SEP)ECQHLIRWCLALRPSDRPTFEEIQNHPWMQDVLLPQETAEIHLHSLSPGPS
>Entity 2
ARKRRRHPSGPPTA
|
|
| PDBID: | 8r0q | | Status: | HPUB -- hold until publication | | Title: | Pim1 in complex with 6-bromo-1H-benzo[d]imidazol-2-amine and Pimtide | | Authors: | Hochban, P.M.M., Heine, A., Diederich, W.E. | | Deposition date: | 2023-10-31 | | Sequence: | >Entity 1
SMLLSKINSLAHLRAAPCNDLHATKLAPGKEKEPLESQYQVGPLLGSGGFGSVYSGIRVSDNLPVAIKHVEKDRISDWGELPNGTRVPMEVVLLKKVSSGFSGVIRLLDWFERPDSFVLILERPEPVQDLFDFITERGALQEELARSFFWQVLEAVRHCHNCGVLHRDIKDENILIDLNRGELKLIDFGSGALLKDTVYTDFDGTRVYSPPEWIRYHRYHGRSAAVWSLGILLYDMVCGDIPFEHDEEIIGGQVFFRQRVS(SEP)ECQHLIRWCLALRPSDRPTFEEIQNHPWMQDVLLPQETAEIHLHSLSPGPS
>Entity 2
ARKRRRHPSGPPTA
|
|
