| PDBID: | 8upk | | Status: | HPUB -- hold until publication | | Title: | Pr/Pfr heterodimer (hybrid) state of Stigmatella aurantiaca bacteriophytochrome 2 | | Authors: | Malla, T.N., Schmidt, M., Stojkovic, E.A. | | Deposition date: | 2023-10-22 |
|
| PDBID: | 8upb | | Status: | HPUB -- hold until publication | | Title: | De novo designed IL-6 mimetic | | Authors: | Borowska, M.T., Jude, K.M., Garcia, K.C. | | Deposition date: | 2023-10-22 |
|
| PDBID: | 8upd | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-22 |
|
| PDBID: | 8upe | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-22 |
|
| PDBID: | 8upg | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-22 |
|
| PDBID: | 8upj | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-22 |
|
| PDBID: | 8upa | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-22 |
|
| PDBID: | 8wv0 | | Status: | HPUB -- hold until publication | | Title: | Outer membrane porin of Burkholderia pseudomallei (BpsOmp38) | | Authors: | Bunkum, P., Aunkham, A., Bert van den, B., Robinson, R.C., Suginta, W. | | Deposition date: | 2023-10-22 |
|
| PDBID: | 8wv1 | | Status: | HPUB -- hold until publication | | Title: | Ambient Temperature Structure of 50S Ribosomal Subunit from Thermus Thermophilus | | Authors: | DeMirci, H., Tosun, B. | | Deposition date: | 2023-10-22 |
|
| PDBID: | 8wuz | | Status: | HPUB -- hold until publication | | Title: | Development of 2-imino-2,3,5,6,7,8-hexahydropyrido[4,3-d]pyrimidin-4(1H)-one derivatives as human caseinolytic peptidase P (hClpP) activators | | Authors: | Jiang, J.-X., Ding, H., Chen, M.-R., Lu, M.-L., Sun, H.-Y., Xiao, Y.-B. | | Deposition date: | 2023-10-22 |
|
| PDBID: | 8wv2 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-22 | | Sequence: | >Entity 1
MLTDNWKELAGKAQSTFQKSLKQAIELADFDEGLAKRYGALPSAIGANVEDFGSPAQFPLEEYLKALPKKVLDITEKDPVELLKDLKSRKVTCVEVLKAYTAASIVASKLTNCVQEFLPIEALQYAQKLDADYETKKHLPLYGLPFSIKEMIPFVGRSVTHGSLCYLDRIVDYNADIVNILIANGAYPFVRTTNPQSLMMLECVSFSHGRTVNAYNGMLTSGGSSGGEGALNGMRASPFGLGSDIGGSIRCPAAFNGIYGLRSTLGRIPTADYFSCNRGSESILSVTGPLSRSLDTVNLVMKTVIEAKPWLIDPTLVPLDWKRPENKKFRVGIYVSDHIVNPSPPINRALSMVTEKLKSLGNFEVVTFEPYKPEKVTEILGKLYFEDGARDFRATLQTGEPLLEQTRWAIEGAEDLDMHDQWYWNLQKQAYRKEFLKHWCSYTDNDGNVLDAVIAPVFPNVAAKHETTKYWTYTSQWNLLDYPVLAFPVTKVDESLDQPYKNYKPLNDLDKYFYEQYDSPSSFKNAPANLCLVGLRFTDEKLVEIANILRN
|
|
| PDBID: | 8wv3 | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-10-23 | | Release date: | 2024-10-23 |
|
| PDBID: | 8wv7 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2023-10-23 |
|
| PDBID: | 8upz | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-23 |
|
| PDBID: | 8uq0 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-23 |
|
| PDBID: | 8uqh | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-23 |
|
| PDBID: | 8upm | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-23 |
|
| PDBID: | 8uqg | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-23 |
|
| PDBID: | 8upy | | Status: | HPUB -- hold until publication | | Title: | Methanosarcine mazei tRNAPyl in A-site of ribosome | | Authors: | Krahn, N., Zhang, J., Melnikov, S.V., Tharp, J.M., Villa, A., Patel, A., Howard, R.J., Gabir, H., Patel, T.R., Stetefeld, J., Puglisi, J., Soll, D. | | Deposition date: | 2023-10-23 |
|
| PDBID: | 8upx | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-23 |
|
| PDBID: | 8uq7 | | Status: | HPUB -- hold until publication | | Title: | Alzheimer''s disease PHF complexed with PET ligand MK-6240 | | Authors: | Kunach, P., Shahmoradian, S.H., Diamond, M.I., Rosa-Neto, P. | | Deposition date: | 2023-10-23 |
|
| PDBID: | 8uqj | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-23 |
|
| PDBID: | 8uqf | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-23 |
|
| PDBID: | 8uqk | | Status: | HPUB -- hold until publication | | Title: | Pfr state of photosensory core module of Stigmatella aurantiaca bacteriophytochrome 2 | | Authors: | Malla, T.N., Schmidt, M., Stojkovic, E.A. | | Deposition date: | 2023-10-23 |
|
| PDBID: | 8uqi | | Status: | HPUB -- hold until publication | | Title: | Pr/Pfr heterodimeric state of photosensory core module of Stigmatella aurantiaca bacteriophytochrome 2 | | Authors: | Malla, T.N., Schmidt, M., Stojkovic, E.A. | | Deposition date: | 2023-10-23 |
|
