| PDBID: | 8ic4 | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-02-10 | | Release date: | 2024-08-20 |
|
| PDBID: | 9d6w | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of Apo Human Prostaglandin reductase 1 (PTGR1) (Monoclinic P form) | | Authors: | Seattle Structural Genomics Center for Infectious Disease, Seattle Structural Genomics Center for Infectious Disease (SSGCID) | | Deposition date: | 2024-08-16 | | Sequence: | >Entity 1
MAHHHHHHMGTLEAQTQGPGSMTKTWTLKKHFVGYPTNSDFELKTSELPPLKNGEVLLEALFLTVDPYMRVAAKRLKEGDTMMGQQVAKVVESKNVALPKGTIVLASPGWTTHSISDGKDLEKLLTEWPDTIPLSLALGTVGMPGLTAYFGLLEICGVKGGETVMVNAAAGAVGSVVGQIAKLKGCKVVGAVGSDEKVAYLQKLGFDVVFNYKTVESLEETLKKASPDGYDCYFDNVGGEFSNTVIGQMKKFGRIAICGAISTYNRTGPLPPGPPPEIVIYQELRMEAFVVYRWQGDARQKALKDLLKWVLEGKIQYKEYIIEGFENMPAAFMGMLKGDNLGKTIVKA
|
|
| PDBID: | 8yb2 | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of the oxygen-bound form of F393H P450BM3 with N-enanthyl-L-prolyl-L-phenylalanine in complex with styrene | | Authors: | Nagao, S., Kuwano, W., Tosha, T., Yamashita, K., Stanfield, J.K., Kasai, C., Ariyasu, S., Shoji, O., Sugimoto, H., Kubo, M. | | Deposition date: | 2024-02-11 |
|
| PDBID: | 9d78 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | apo-OXA-58 | | Authors: | Maggiolo, A.O., Smith, C.A., Toth, M., Vakulenko, S.B. | | Deposition date: | 2024-08-16 |
|
| PDBID: | 8yb3 | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of the oxygen-bound form of F87A/F393H P450BM3 with N-enanthyl-L-prolyl-L-phenylalanine in complex with styrene | | Authors: | Nagao, S., Kuwano, W., Tosha, T., Yamashita, K., Stanfield, J.K., Kasai, C., Ariyasu, S., Shoji, O., Sugimoto, H., Kubo, M. | | Deposition date: | 2024-02-11 |
|
| PDBID: | 8ic5 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2023-02-10 | | Release date: | 2024-08-10 |
|
| PDBID: | 9d7j | | Status: | HPUB -- hold until publication | | Title: | Clostridium acetobutylicum alcohol dehydrogenase bound to NADP+ | | Authors: | Madzelan, P., Wilson, M.A. | | Deposition date: | 2024-08-16 | | Sequence: | >Entity 1
(MSE)GSSHHHHHHSSGLVPRGSH(MSE)KEYKYTVITGASSGIGYEAAKAFAKRGKNLIIIARRREKLEELKKEILHYNRSLKVIVKSIDLSITSNVYSLYDELKNYNIETLVNNAGFGDYSKVNNQNLEKVES(MSE)LSLNIEALVILSSLFVRDYEKIEGTQLINISSAGGYTIVPNAVIYCATKFFVSSFTEGLARELIEAKSNLKAKVLAPAATETEFGKVASDVKEYDYQEKFHKYHTSKQ(MSE)AEFLIKLYDNDYIVGKVDRNSFKFTLQNPIFDYA
|
|
| PDBID: | 8yba | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-12 |
|
| PDBID: | 9d7c | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | OXA-58-NA-1-157 10 min complex | | Authors: | Smith, C.A., Maggiolo, A.O., Toth, M., Vakulenko, S.B. | | Deposition date: | 2024-08-16 |
|
| PDBID: | 8id0 | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-02-11 | | Release date: | 2024-10-11 |
|
| PDBID: | 8yb9 | | Status: | HPUB -- hold until publication | | Title: | Yeast NPC pre-60S assembly intermediate (state C13) | | Authors: | Chen, S.J.B., Sui, S.F. | | Deposition date: | 2024-02-12 |
|
| PDBID: | 9d7n | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-08-16 |
|
| PDBID: | 8yb8 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-12 |
|
| PDBID: | 8ybc | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-02-12 |
|
| PDBID: | 8id7 | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-02-12 | | Release date: | 2024-10-12 |
|
| PDBID: | 9d7k | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Infectious B19V capsid | | Authors: | Lee, H., Hafenstein, S. | | Deposition date: | 2024-08-16 |
|
| PDBID: | 8id5 | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-02-12 | | Release date: | 2024-11-12 |
|
| PDBID: | 8ybd | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-13 |
|
| PDBID: | 9d7o | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | BG505 HIV-1 Env with 1 CH103 WT Fab bound | | Authors: | Parsons, R.J., Acharya, P. | | Deposition date: | 2024-08-16 |
|
| PDBID: | 8ybi | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-14 |
|
| PDBID: | 9d7q | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Water and chloride as allosteric inhibitors in WNK kinase osmosensing | | Authors: | Akella, R., Goldsmith, E.J. | | Deposition date: | 2024-08-16 |
|
| PDBID: | 9d7p | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | BG505 HIV-1 Env with 2 CH103 WT Fabs bound | | Authors: | Parsons, R.J., Acharya, P. | | Deposition date: | 2024-08-16 |
|
| PDBID: | 8ybl | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-15 |
|
| PDBID: | 9d7u | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-08-17 |
|
| PDBID: | 8ybm | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-15 |
|
