| PDBID: | 8xb6 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Portal-vertex of SH-Ab15497 in C1 symmetry | | Authors: | Lin, J., Zhao, S.W. | | Deposition date: | 2023-12-05 |
|
| PDBID: | 8xan | | Status: | HPUB -- hold until publication | | Title: | Major tail protein of SH-Ab15497 | | Authors: | Lin, J., Zhao, S.W. | | Deposition date: | 2023-12-05 |
|
| PDBID: | 8xb1 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of FLT3 in complex with a Pyrazinamide Macrocycle derivative | | Authors: | Guo, M., Chen, Y. | | Deposition date: | 2023-12-05 |
|
| PDBID: | 8xao | | Status: | HPUB -- hold until publication | | Title: | The thermostable and acid-tolerant DNA-binding protein | | Authors: | Chen, C.Y., Huang, C.H. | | Deposition date: | 2023-12-05 |
|
| PDBID: | 8xap | | Status: | HPUB -- hold until publication | | Title: | Thermostable and acid-tolerant DNA-binding protein | | Authors: | Chen, C.Y., Huang, C.H. | | Deposition date: | 2023-12-05 |
|
| PDBID: | 8xaq | | Status: | HPUB -- hold until publication | | Title: | The thermostable and acid-tolerant DNA-binding protein | | Authors: | Chen, C.Y., Huang, C.H. | | Deposition date: | 2023-12-05 |
|
| PDBID: | 8xaz | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-05 |
|
| PDBID: | 8rci | | Status: | HPUB -- hold until publication | | Title: | Human p53 DNA-binding domain bound to DARPin C10 | | Authors: | Balourdas, D.I., Muenick, P., Strubel, A., Knapp, S., Dotsch, V., Joerger, A.C., Structural Genomics Consortium (SGC) | | Deposition date: | 2023-12-06 |
|
| PDBID: | 8rce | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of PPAR alfa Ligand Binding Domain in complex with the ligand LBB78 | | Authors: | Capelli, D., Montanari, R. | | Deposition date: | 2023-12-06 | | Sequence: | >Entity 1
HHHHHHSSGLVPRGSHTADLKSLAKRIYEAYLKNFNMNKVKARVILSGKASNNPPFVIHDMETLCMAEKTLVAKLVANGIQNKEAEVRIFHCCQCTSVETVTELTEFAKAIPGFANLDLNDQVTLLKYGVYEAIFAMLSSVMNKDGMLVAYGNGFITREFLKSLRKPFCDIMEPKFDFAMKFNALELDDSDISLFVAAIICCGDRPGLLNVGHIEKMQEGIVHVLRLHLQSNHPDDIFLFPKLLQKMADLRQLVTEHAQLVQIIKKTESDAALHPLLQEIYRDMY
|
|
| PDBID: | 8rc5 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-06 |
|
| PDBID: | 8v8t | | Status: | HPUB -- hold until publication | | Title: | Asymmetrical subunit from a Drp1 lattice on PA nanotubes | | Authors: | Rochon, K., Peng, R., Stagg, S.M., Mears, J.A. | | Deposition date: | 2023-12-06 |
|
| PDBID: | 8v90 | | Status: | HPUB -- hold until publication | | Title: | TtgR variant 3A7 with naltrexone | | Authors: | Acheson, J.F., Lee, D., Ramen, S. | | Deposition date: | 2023-12-06 |
|
| PDBID: | 8v8s | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-06 |
|
| PDBID: | 8xbl | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-06 |
|
| PDBID: | 8xbc | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-06 |
|
| PDBID: | 8xbk | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of Human Liver Fructose-1,6-bisphosphatase Complexed with a Covalent Inhibitor | | Authors: | Cao, H., Zhang, X., Ren, Y., Wan, J. | | Deposition date: | 2023-12-06 |
|
| PDBID: | 8xbb | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-06 |
|
| PDBID: | 8xbq | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-06 |
|
| PDBID: | 8xbo | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-06 |
|
| PDBID: | 8xbr | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-06 |
|
| PDBID: | 8xba | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-06 |
|
| PDBID: | 8xbm | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-06 |
|
| PDBID: | 8xbj | | Status: | HPUB -- hold until publication | | Title: | The X-ray structure of F46C myoglobin with a covalently linked Ni-complex | | Authors: | Lin, Y.W., Yuan, H. | | Deposition date: | 2023-12-06 |
|
| PDBID: | 8xbn | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of Arabidopsis N-amino acetyltransferase NATA1 bound to CoA and HEPES | | Authors: | Hameed, U.F.S., Arold, S.T. | | Deposition date: | 2023-12-06 |
|
| PDBID: | 8xbp | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of AtNATA1 bound to Acetyl CoA | | Authors: | Hameed, U.F.S., Arold, S.T. | | Deposition date: | 2023-12-06 |
|
