| PDBID: | 8wck | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | FCP tetramer in Chaetoceros gracilis | | Authors: | Feng, Y., Li, Z., Zhou, C., Shen, J.-R., Liu, C., Wang, W. | | Deposition date: | 2023-09-12 |
|
| PDBID: | 8wcl | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | FCP pentamer in Chaetoceros gracilis | | Authors: | Feng, Y., Li, Z., Zhou, C., Liu, C., Shen, J.-R., Wang, W. | | Deposition date: | 2023-09-12 |
|
| PDBID: | 8wcj | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of GB3 penta mutation L5V/K10H/T16S/K19E/Y33I | | Authors: | Qin, M.M., Chen, X.X., Zhang, X.Y., Song, X.F., Yao, L.S. | | Deposition date: | 2023-09-12 |
|
| PDBID: | 8qjb | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-13 |
|
| PDBID: | 8qjk | | Status: | HPUB -- hold until publication | | Title: | Structure of the cytoplasmic domain of csx23 from Vibrio cholera in complex with cyclic tetra-adenylate (cA4) | | Authors: | McMahon, S.A., McQuarrie, S., Gloster, T.M., Gruschow, S., White, M.F. | | Deposition date: | 2023-09-13 | | Sequence: | >Entity 1
GANAMDEITVVLKSPNGKNIKCPPMPRKDFSRAEVLGYIGMCSGAQRFEIASLKTPKFGENLLKIIKSKGSQSFIVDCTDEEIDQFSAETKSGSNA
>Entity 2
AAAA
|
|
| PDBID: | 8qjl | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-13 |
|
| PDBID: | 8qjm | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-13 |
|
| PDBID: | 8qjn | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-13 |
|
| PDBID: | 8qjo | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-13 |
|
| PDBID: | 8qjd | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-13 |
|
| PDBID: | 8qjc | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2023-09-13 |
|
| PDBID: | 8qja | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-13 |
|
| PDBID: | 8qju | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-13 |
|
| PDBID: | 8qjp | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-13 |
|
| PDBID: | 8qjq | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-13 |
|
| PDBID: | 8qji | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of GSK3b in complex with N-(4-(5-(1,2,4-oxadiazol-3-yl)thiophen-2-yl)pyridin-2-yl)cyclopropanecarboxamide inhibitor (TW362) | | Authors: | Slugocka, E.A., Grygier, P., Wichur, T., Czarna, A., Wieckowska, A. | | Deposition date: | 2023-09-13 | | Sequence: | >Entity 1
MKVSRDKDGSKVTTVVATPGQGPDRPQEVSYTDTKVIGNGSFGVVYQAKLCDSGELVAIKKVLQDKRFKNRELQIMRKLDHCNIVRLRYFFYSSGEKKDEVYLNLVLDYVPETVYRVARHYSRAKQTLPVIYVKLYMYQLFRSLAYIHSFGICHRDIKPQNLLLDPDTAVLKLCDFGSAKQLVRGEPNVS(PTR)ICSRYYRAPELIFGATDYTSSIDVWSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQIREMNPNYTEFKFPQIKAHPWTKVFRPRTPPEAIALCSRLLEYTPTARLTPLEACAHSFFDELRDPNVKLPNGRDTPALFNFTTQELSSNPPLATILIPPHARENLYFQ
|
|
| PDBID: | 8qje | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-13 |
|
| PDBID: | 8qjf | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-13 |
|
| PDBID: | 8qjv | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-13 |
|
| PDBID: | 8qjh | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-13 |
|
| PDBID: | 8qjg | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-13 |
|
| PDBID: | 8u62 | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of PsBphP in Pfr state, Dimer of Dimers FL | | Authors: | Basore, K., Burgie, E.S., Vierstra, D. | | Deposition date: | 2023-09-13 |
|
| PDBID: | 8u63 | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of PsBphP in Pfr state, Dimer of Dimers PSM only | | Authors: | Basore, K., Burgie, E.S., Vierstra, D. | | Deposition date: | 2023-09-13 |
|
| PDBID: | 8u64 | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of PsBphP in Pfr state, medial PSM only | | Authors: | Basore, K., Burgie, E.S., Vierstra, D. | | Deposition date: | 2023-09-13 |
|
| PDBID: | 8u65 | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of PsBphP in Pfr state, splayed PSM only | | Authors: | Basore, K., Burgie, E.S., Vierstra, D. | | Deposition date: | 2023-09-13 |
|
