PDBID: | 8qiw | Status: | HPUB -- hold until publication | Deposition date: | 2023-09-12 |
|
PDBID: | 8qj1 | Status: | HOLD -- hold until a certain date | Deposition date: | 2023-09-12 | Release date: | 2024-09-12 |
|
PDBID: | 8qiz | Status: | WAIT -- processing started, waiting for author input to continue processing | Title: | Crystal structure of Paradendryphiella salina PL7C alginate lyase mutant H124 soaked with with penta-mannuronic acid | Authors: | Wilkens, C. | Deposition date: | 2023-09-12 |
|
PDBID: | 8qj5 | Status: | HPUB -- hold until publication | Title: | Crystal structure of the Levansucrase beta from Pseudomonas syringae pv. actinidiae | Authors: | Ferraroni, M., Peritore, L. | Deposition date: | 2023-09-12 |
|
PDBID: | 8qiy | Status: | HPUB -- hold until publication | Title: | Structure of Mycobacterium abscessus Phosphopantetheine adenylyltransferase in complex with inhibitor | Authors: | Thomas, S.E., McCarthy, W.J., Coyne, A.G., Blundell, T.L. | Deposition date: | 2023-09-12 |
|
PDBID: | 8qix | Status: | HPUB -- hold until publication | Title: | Structure of Mycobacterium abscessus Phosphopantetheine adenylyltransferase in complex with inhibitor | Authors: | Thomas, S.E., McCarthy, W.J., Coyne, A.G., Blundell, T.L. | Deposition date: | 2023-09-12 |
|
PDBID: | 8qj6 | Status: | HPUB -- hold until publication | Title: | Crystal structure of cytochrome domain 1 from PgcA | Authors: | Nash, B.W., Edwards, M.J., Clarke, T.A. | Deposition date: | 2023-09-12 |
|
PDBID: | 8qj8 | Status: | HPUB -- hold until publication | Title: | Structure of Mycobacterium abscessus Phosphopantetheine adenylyltransferase in complex with inhibitor | Authors: | Thomas, S.E., McCarthy, W.J., Coyne, A.G., Blundell, T.L. | Deposition date: | 2023-09-12 |
|
PDBID: | 8qj2 | Status: | HPUB -- hold until publication | Title: | Structure of active state MC4R in complex with a potent ligand mimicking nanobody | Authors: | Busch, A., Jaakola, V.-P., Masiulis, S. | Deposition date: | 2023-09-12 |
|
PDBID: | 8qj9 | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2023-09-12 |
|
PDBID: | 8u5l | Status: | HPUB -- hold until publication | Title: | MAU868, a novel human-derived monoclonal neutralizing antibody targeting BK virus VP1 | Authors: | Knapp, M.S., Ornelas, E. | Deposition date: | 2023-09-12 |
|
PDBID: | 8u5i | Status: | AUTH -- processed, waiting for author review and approval | Title: | Crystal Structure of human IDO1 bound to Compound 23 | Authors: | Steinbacher, S., Lammens, A., Harris, S.F. | Deposition date: | 2023-09-12 |
|
PDBID: | 8u5o | Status: | HPUB -- hold until publication | Title: | The structure of the catalytic domain of NanI sialdase in complex with Neu5Gc | Authors: | Medley, B.J., Low, K.E., Garber, J.M., Gray, T.E., Liu, L., Klassen, L., Fordwour, O.B., Inglis, G.D., Boons, G.J., Zandberg, W.F., Abbott, W.D., Boraston, A.B. | Deposition date: | 2023-09-12 |
|
PDBID: | 8u59 | Status: | HPUB -- hold until publication | Title: | EcDsbA soaked with N-(2-fluorophenyl)-5-methylisoxazole-3-carboxamide and N-(4-(thiophen-3-yl)benzyl)cyclohexanamine | Authors: | Wang, G., Heras, B. | Deposition date: | 2023-09-12 | Sequence: | >Entity 1 AQYEDGKQYTTLEKPVAGAPQVLEFFSFFCPHCYQFEEVLHISDNVKKKLPEGVKMTKYHVNFMGGDLGKDLTQAWAVAMALGVEDKVTVPLFEGVQKTQTIRSASDIRDVFINAGIKGEEYDAAWNSFVVKSLVAQQEKAAADVQLRGVPAMFVNGKYQLNPQGMDTSNMDVFVQQYADTVKYLSEKK
|
|
PDBID: | 8u57 | Status: | HPUB -- hold until publication | Deposition date: | 2023-09-12 |
|
PDBID: | 8u56 | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2023-09-12 |
|
PDBID: | 8u58 | Status: | HPUB -- hold until publication | Deposition date: | 2023-09-12 |
|
PDBID: | 8u5c | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2023-09-12 |
|
PDBID: | 8u5n | Status: | HPUB -- hold until publication | Deposition date: | 2023-09-12 |
|
PDBID: | 8u5q | Status: | HPUB -- hold until publication | Deposition date: | 2023-09-12 |
|
PDBID: | 8u54 | Status: | HPUB -- hold until publication | Deposition date: | 2023-09-12 |
|
PDBID: | 8u5s | Status: | HPUB -- hold until publication | Deposition date: | 2023-09-12 |
|
PDBID: | 8wch | Status: | HPUB -- hold until publication | Deposition date: | 2023-09-12 |
|
PDBID: | 8wci | Status: | HPUB -- hold until publication | Deposition date: | 2023-09-12 |
|
PDBID: | 8wcg | Status: | HPUB -- hold until publication | Title: | Crystal structure of SARS-CoV-1 RBD in complex with nanobody aSR29 and aSR347 | Authors: | Zeng, W.H., Ma, H., Jin, T.C. | Deposition date: | 2023-09-12 |
|